1162576415 (01162576415)
Who called me from phone number 1162576415 Leicester
Who called me from 1162576415
Phone number 1162576415 it's a landline number from Leicester. This phone number has been searched 1 times. The first search was on 2026-02-20 09:51:07 and the last on 2026-02-20 10:52:07. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1162576415 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+44116
Phone number 1162576415 - 0 opinions
Reviews for phone number 1162576415
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1162576415
QR Codes for number +44 1162576415




Phone number 1162576415 (+441162576415)
Country: United Kingdom
Country code: +44 (0044)
City: Leicester
Directional local: 116 (0116)
Code: 44116 (0044116)
This number was searched 1 times
First date of search: 2026-02-20 09:51:07
Date of last check of this number: 2026-02-20 10:52:07
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 146752611
A similar number: 116257830, 116257976, 116257652, 116257201, 117157641, 117157641, 117757641, 118857641(11 62 57 830,11 62 57 976,11 62 57 652,11 62 57 201,11 71 57 641,11 71 57 641,11 77 57 641,11 88 57 641)
Previous phone numbers: 1162576414 1162576413 1162576412 1162576411 1162576410 1162576409 1162576408 1162576407 1162576406 1162576405 1162576404 1162576403 1162576402 1162576401 1162576400 1162576399 1162576398 1162576397 1162576396 1162576395 1162576394 1162576393 1162576392 1162576391 1162576390 1162576389 1162576388 1162576387 1162576386 1162576385 1162576384 1162576383 1162576382 1162576381 1162576380 1162576379 1162576378 1162576377 1162576376 1162576375 1162576374 1162576373 1162576372 1162576371 1162576370 1162576369 1162576368 1162576367 1162576366 1162576365 1162576364 1162576363 1162576362 1162576361 1162576360 1162576359 1162576358 1162576357 1162576356 1162576355 1162576354 1162576353 1162576352 1162576351
Next phone numbers: 1162576416 1162576417 1162576418 1162576419 1162576420 1162576421 1162576422 1162576423 1162576424 1162576425 1162576426 1162576427 1162576428 1162576429 1162576430 1162576431 1162576432 1162576433 1162576434 1162576435 1162576436 1162576437 1162576438 1162576439 1162576440 1162576441 1162576442 1162576443 1162576443 1162576444 1162576445 1162576446 1162576447 1162576448 1162576449 1162576450 1162576451 1162576452 1162576453 1162576454 1162576455 1162576456 1162576457 1162576458 1162576459 1162576460 1162576461 1162576462 1162576463 1162576464 1162576465 1162576466 1162576467 1162576468 1162576469 1162576470 1162576471 1162576472 1162576473 1162576474 1162576475 1162576476 1162576477 1162576478 1162576479 1162576480 1162576481 1162576482 1162576484 1162576484 1162576485
(Previous phone numbers: 01162576414 01162576413 01162576412 01162576411 01162576410 01162576409 01162576408 01162576407 01162576406 01162576405 01162576404 01162576403 01162576402 01162576401 01162576400 01162576399 01162576398 01162576397 01162576396 01162576395 01162576394 01162576393 01162576392 01162576391 01162576390 01162576389 01162576388 01162576387 01162576386 01162576385 01162576384 01162576383 01162576382 01162576381 01162576380 01162576379 01162576378 01162576377 01162576376 01162576375 01162576374
Next phone numbers: 01162576416 01162576417 01162576418 01162576419 01162576420 01162576421 01162576422 01162576423 01162576424 01162576425 01162576426 01162576427 01162576428 01162576429 01162576430 01162576431 01162576432 01162576433 01162576434 01162576435 01162576436 01162576437 01162576438 01162576439 01162576440 01162576441 01162576442 01162576443 01162576443 01162576444 01162576445 01162576446 01162576447 01162576448 01162576449 01162576450 01162576451 01162576452 01162576453 01162576453 01162576454)
+44 01162576415 reviews
Add your opinion about +441162576415
UK 1162576415
unlimited mobile phone plans
Who called from number 1162576415
You can rate other simmilar phone numbers from Leicester, searched in our database
| 1162579353 | 1162540672 | 1162553479 |
| 1162978063 | 1162943117 | 1162231497 |
Random searched phone numbers
| 620 994 3122 | 470 126 7702 | 816 629 7735 |
| 385 538 6833 | 296 061 0756 | 959 452 2053 |
Top rated phone numbers
7076288207 social media consultants limited rickmansworth hertfordshire1733560570 index gear and engineering ltd
1513275611 WIRRAL
2038050585 A complete scam as my AV is up to date Just close the browser and get on with your life
1793433431 swindon fashion shops the jaeger co ltd
2076076868 florists - retail rosies florist London
1704536476 fashion shops jeanster southport merseyside
1264790463 andover indian moghul tandoori restaurant
1407762614 pubs bars and inns dublin packet inn - Holyhead
1633895133 Missed call
1214408048 avonew precision engineering ltd aircraft components birmingham b12 1tb
7914439851 London
1513759623 Call centre annoying has already told get my number off that system has thats us right dont know how they got this number has its a brand new SIM
1323430251 restaurants the ranch restaurant eastbourne
1920500024 3 calls today trying to get money I suspect Had the name of someone from 10 years ago ended the call when I said they didnt live here
8005626818 v PVN Gang says Fuck Fuck You Ghost
2381872379 Pension scamPolice and Hampshire trading standards are dealing with this matterDo not release any personal information to the unidentified caller
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
1892671945 calverley carpets
1342715265 sky design print ltd Graphic designers crawley rh10 3ez
1143496488 gas and electricity savings
1789562362 01789565362 phoned this morning at 1045 Did not answer - they didnt leave a message Checked the number with this site and it confirmed I was right NOT to answer it I have a call blocker and recommend everyone to get one
7983832075 Fraud - Has been shown to conduct a University assignmentexam help scam on unsuspecting students at exorbitant prices DO NOT TRUST
8455577673 Health Insurance - multiple silent calls they must want you to call back on expensive premium number
2085461216 john warren bookmakers kingston upon thames kt1 2hr
1691671770 construction equipments griffiths hire shops oswestry
1132537211 vallance ltd leeds 2462
2877741392 w j kealey livestock and others londonderry county londonderry
1245474135 Driving Schools The Driving Academy Chelmsford
1525608107 Saying you have been in a car accident
Number popularity chart 1162576415
Your opinion about telephone number 1162576415 (116 257 6415)
Who called from 01162576415?: Called Leicester ??? Add your opinion about this phone number, maybe you know who called from number 1162 576 415? Maybe it's yours phone number and you can comment on it. Please rate if this phone number is secure and you can pick up this phone. If someone called you from this phone number, someone called or sent you some paid SMS, please add your opinion on our website. Unlimited mobile phone plans. Do not keep the information who called only for myself. Share the description and your opinion on the description of your experience with this number phone, use our form and help other our users. Please rate this phone number (+44 011 62 57 641) is it a secure number and you can answer the call. Thank you for yoursreviews.
Possible number records of 01162576415 01162-576-415
+441162576415 |
00441162576415 |
1162 576 415 |
11 62 57 641 5 |
116 25 76 41 5 |
11-62-57-641 5 |
0044 1162-576-415 |
00 44 116 25 76 415 |
(+44)1162576415 |
11 62 57 641 5 |
(11) 6257 641 5 |
00 44 (11)6 25-76-41-5 |
+441162576415 In words... 116 257 6415
one one six two five seven six four one |
eleven sixty two fifty seven sixty four fifteen |
Possible number records of 1162576415
Last rated phone numbers
2034673641, 7753380363, 7978299703, 7537416300, 7820654673, 7538929990, 7456953277, 7476021807, 7487353774, 7487353774, 1902943972, 7480258922, 2045200399, 1163502892, 1969622775, 7934686266, 2039917613, 2034754766, 2045711197, 2382622037, 2038179694, 1204375295, 7441410718, 7441410718, 1702418530, 7436367055, 7984380427, 7435705358, 64057, 2035198029, 2035198029, 7379861792, 1313811478, 7441913149, 1372736232, 1173259164, 7456207537, 7487256090, 1357333025, 2038465513, 7359303633, 2076341535, 63366, 7458148209, 1915800092, 7715623848, 7907413017, 2038891669, 2031502547, 7931412456,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988492223
- Pageviews today : 662623
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
1162576415
+441162576415
stablemate systems ltd chesham
Clipped message stating that if I didn't get in contact with them immediately they would decline my card, they did not say who they were or who they wanted to speak to but seeing as the call originated in Italy, it is a Scam
Scam call about domain names and services
hung up when answered
Driving Schools A Sureway Driving School Clacton-on-Sea
Supermarkets Costcutter Goole North Humberside
carpet and upholstery cleaners harvey's carpet cleaning gillingham
Thornton Heath
want to know if you've had credit cards.
Third call about a non-existent accident in which I was supposed to have been injured 2.5 years ago
accountants d &co chakrabarti (London)
01789565362 phoned this morning at 10.45. Did not answer - they didn't leave a message. Checked the number with this site and it confirmed I was right NOT to answer it. I have a call blocker and recommend everyone to get one.
Answered but remained silent waiting for the caller to speak first - caller immediately rang off.
edwins bride & groom service wedding services ballymena county antrim
promotional items j m b publications christchurch dorset
the northern ireland community relations council information services belfast ulster
Number unknown, so didn't answer it. They left no message, so can't be too important...
john warren bookmakers kingston upon thames kt1 2hr
Waiting for emergency doctors to ring me while trying to bring the temperature of my feverish child down in the bath,phone rings only this silly number in the meantime I missed ...
marketing consultants linden marketing associates lichfield
central government the probation service - Bargoed
auto body repairs j c autos todmorden lancashire
Asian person
colorscan high wycombe g wholesale and retail
menswear savage ashton-under-lyne lancashire
ca underwriting ltd poole j financial intermediation
driving schools start right school of motoring
WINDSOR
clayton construction ltd weston super mare erection of roof covering and frames
PayStream accountants
pension ppi
ceiling contractors shropshire ceilings shrewsbury
I grobler dentists farnham gu9 7lp
philip lynn belfast k business services
keep calling slightly diff nos
chemists and pharmacists roughwood chemists liverpool merseyside
lily d's cafes and tea rooms coleraine county londonderry
Bracknell
golf courses and clubs castle douglas golf club
sheet metal work t c s fabrications oldham lancashire
Not know but as I have blocked their other numbers presume the scum have gone on to the next one on their predial
interior designers and furnishers mcc mosaics & design (London)
Get a lot of calls from this number from Dorking. Now blocked
doctors general practitioners shepherd, m a w st leonards on sea
sculptors and carvers peter newell sculpture studio barnstaple
stack and computer solutions ltd bootle k business services
Call centre
Rings several times a day. I'm sick of it so blocked it ...
dunfermline
MARGATE
Nottingham
mr boot - shoe shops Bradford
lies about you being in an accident
bradford van hire - van and truck hire Bradford
japanese translating norwich k business services
estate agents octavia estates (London)
Watford
Road Haulage Gordons Transport Ltd Goole North Humberside
scammer
air condition and refrigeration unit air conditioning systems ltd orpington
This number was calling me for a few months. Most of a time he/she just rand on the phone. Then sometimes I caught phone on time and picked up but person on other side hung up. The last time I pick up the phone and after few seconds man on other side (soun
07703218192
Debt management company
Keep ringing to undertake a survey, despite being told not to less and less politely. When asked not ring, the response is We will after you take the survey
London stock
Was a local number to me so answered whilst abroad and it was someone saying I had been involved in an accident
avonew precision engineering ltd aircraft components birmingham b12 1tb
charities and voluntary organisations national pet week (London)
scam about a car accident I was supposed to be involved in. think it computer generated
Missed a call from and call back machine answerd and stated this call is recorded by talk talk safe net and dropped
melksham indian the melksham tandoori
They've rang me twice now and if it's a company cold calling? I'm not interested
luke curran & co solicitors newry county down
charities and voluntary organisations british red cross beckenham
garages - repair and modification batty & oliver barnsley
Rate 6 annoying!
spunkies london other business activities
Bank fraud call. Watch out. Blocked.
Safe number
SCAM
ims
furniture repair millennium customised furniture
general stores - retail chandhok stores (London)
systems & services computer systems and software croydon cr0 3ex
They seemed to know who I was and wanted my confirmation details. People laughing in the background clearly trying to scam me.
halberton primary school tiverton general secondary education
martial arts instruction scottish shokatan centre
st johns rc aided first school alnwick education
Was unable to answer because I was at work, but glad I looked up number first.
biffa waste services ltd - waste disposal services Brighouse
estate agents bradleys estate agents exeter
middlesex itec ltd
hahahahhahhahahhhahahhhahahahahahahahahahahahahahahahahahahahahah
places of worship st Margarets parish church
don't want it
This number calls constantly day and night Initialy no one speaks so hang up
44749586667
none london essex
Ring too many times
09685849843