1908300280 (01908300280)
Who called me from phone number 1908300280 Milton Keynes
Who called me from 1908300280
Phone number 1908300280 it's a landline number from Milton Keynes. This phone number has been searched 1 times. The first search was on 2026-02-20 09:57:07 and the last on 2026-02-20 10:58:07. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1908300280 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+441908
Phone number 1908300280 - 0 opinions
Reviews for phone number 1908300280
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1908300280
QR Codes for number +44 1908300280




Phone number 1908300280 (+441908300280)
Country: United Kingdom
Country code: +44 (0044)
City: Milton Keynes
Directional local: 1908 (01908)
Code: 441908 (00441908)
This number was searched 1 times
First date of search: 2026-02-20 09:57:07
Date of last check of this number: 2026-02-20 10:58:07
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 820038091
A similar number: 190830987, 190830300, 19083089, 190830367, 198430028, 198430028, 193230028, 191930028(19 08 30 987,19 08 30 300,19 08 30 89,19 08 30 367,19 84 30 028,19 84 30 028,19 32 30 028,19 19 30 028)
Previous phone numbers: 1908300279 1908300278 1908300277 1908300276 1908300275 1908300274 1908300273 1908300272 1908300271 1908300270 1908300269 1908300268 1908300267 1908300266 1908300265 1908300264 1908300263 1908300262 1908300261 1908300260 1908300259 1908300258 1908300257 1908300256 1908300255 1908300254 1908300253 1908300252 1908300251 1908300250 1908300249 1908300248 1908300247 1908300246 1908300245 1908300244 1908300243 1908300242 1908300241 1908300240 1908300239 1908300238 1908300237 1908300236 1908300235 1908300234 1908300233 1908300232 1908300231 1908300230 1908300229 1908300228 1908300227 1908300226 1908300225 1908300224 1908300223 1908300222 1908300221 1908300220 1908300219 1908300218 1908300217 1908300216
Next phone numbers: 1908300281 1908300282 1908300283 1908300284 1908300285 1908300286 1908300287 1908300288 1908300289 1908300290 1908300291 1908300292 1908300293 1908300294 1908300295 1908300296 1908300297 1908300298 1908300299 1908300300 1908300301 1908300302 1908300303 1908300304 1908300305 1908300306 1908300307 1908300308 1908300308 1908300309 1908300310 1908300311 1908300312 1908300313 1908300314 1908300315 1908300316 1908300317 1908300318 1908300319 1908300320 1908300321 1908300322 1908300323 1908300324 1908300325 1908300326 1908300327 1908300328 1908300329 1908300330 1908300331 1908300332 1908300333 1908300334 1908300335 1908300336 1908300337 1908300338 1908300339 1908300340 1908300341 1908300342 1908300343 1908300344 1908300345 1908300346 1908300347 1908300349 1908300349 1908300350
(Previous phone numbers: 01908300279 01908300278 01908300277 01908300276 01908300275 01908300274 01908300273 01908300272 01908300271 01908300270 01908300269 01908300268 01908300267 01908300266 01908300265 01908300264 01908300263 01908300262 01908300261 01908300260 01908300259 01908300258 01908300257 01908300256 01908300255 01908300254 01908300253 01908300252 01908300251 01908300250 01908300249 01908300248 01908300247 01908300246 01908300245 01908300244 01908300243 01908300242 01908300241 01908300240 01908300239
Next phone numbers: 01908300281 01908300282 01908300283 01908300284 01908300285 01908300286 01908300287 01908300288 01908300289 01908300290 01908300291 01908300292 01908300293 01908300294 01908300295 01908300296 01908300297 01908300298 01908300299 01908300300 01908300301 01908300302 01908300303 01908300304 01908300305 01908300306 01908300307 01908300308 01908300308 01908300309 01908300310 01908300311 01908300312 01908300313 01908300314 01908300315 01908300316 01908300317 01908300318 01908300318 01908300319)
+44 01908300280 reviews
Add your opinion about +441908300280
UK 1908300280
find out unknown caller id
Who called from number 1908300280
You can rate other simmilar phone numbers from Milton Keynes, searched in our database
| 1908355256 | 1908378076 | 1908348546 |
| 1908798133 | 1908462762 | 1908152591 |
Random searched phone numbers
| 979 599 1680 | 254 908 8471 | 546 089 6520 |
| 901 335 6858 | 582 542 9721 | 297 869 602 |
Top rated phone numbers
1883744222 net formation ltd Computer systems and software godstone rh9 8dz1704228207 southport old links southport other sporting activities
1224209967 Counselling and advice aberdeen counselling centre
1342850313 photography - general topham edenbridge
1621817915 Tiling Contractors Ceramic Tiling Colchester
7766055233 reading
2037456462 When I called this number back it rang and then when the minutes started clocking like the phone had been answered the ringing sound continued Therefore I envisage it to be
1183244333 Obviously as scam if you go to text STOP to the number it has charges I havent as yet but will be getting on to O2 to tell them to stop any chargeshave no idea where this came from
1264790463 andover indian moghul tandoori restaurant
1217052566 peter n huntley dentists solihull b91 3ha
2078346318 theatres and concert halls apollo victoria theatre London
1274665513 mr boot - shoe shops Bradford
1273818702 china and glassware - retail the edinburgh crystal glass co brighton
7700900439 Asian person
1306280997 Get a lot of calls from this number from Dorking Now blocked
2877079960 FRAUDOffenders attempt to gain access to o2 account via one-time code sent by text message DO NOT ENGAGE
7545512009 dont answer very rude need investigating
8000521251 Claimed to be from Virgin but I called Virgin and they said this is not a number they have on file Blocked the number Not sure what they were after
2897564532 the sofa centre furniture general ballynahinch county down
7719433926 Chelmsford
1515212202 stack and computer solutions ltd bootle k business services
1414500838 silent caller
740773227 639615501567
1983530260 menswear visual impact newport isle of wight
2081443802 Had two calls from Anshul re energy supply for village hall Thought wed check it out before saying anything to him or giving him the number of the person really responsible for gas and electricity Must have got our details from teh charities commissio
2075537878 strategic dataworks ltd london
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
1142722222 funeral services john heath sons sheffield
1535670381 m and d greenwood keighley n health and social work
1558650347 mixed crops e s davies - Llanwrda
Number popularity chart 1908300280
Your opinion about telephone number 1908300280 (190 830 0280)
Who called from 01908300280?: Who called from UK Milton Keynes ??? Who is calling from 01908300280?? On our site a very transparent way you will check the location of an unknown phone number as well as see the location on the map I check from what city was the connection I check the ranking of the given number his opinion comments and statistical data among others How many times a given Number unknown number was searched for how many views when was the first search date and when was the last search date of this phone number. Don't risk additional costs by calling or receiving a call from an unknown phone number. Always try to check unknown connections by phone numbers you have not seen or do not know yet. It is safe here to check the phone numbers in our database and on other websites. Find out unknown caller id. Tell your friends about our site and let me know that they can check every unknown number in our number database for free at any time at any time. We invite you to check phone numbers and add opinions.
Possible number records of 01908300280 01908-300-280
+441908300280 |
00441908300280 |
1908 300 280 |
19 08 30 028 0 |
190 83 00 28 0 |
19-08-30-028 0 |
0044 1908-300-280 |
00 44 190 83 00 280 |
(+44)1908300280 |
19 08 30 028 0 |
(19) 0830 028 0 |
00 44 (19)0 83-00-28-0 |
+441908300280 In words... 190 830 0280
one nine zero eight three zero zero two eight |
nineteen eight thirty two eighty |
Possible number records of 1908300280
Last rated phone numbers
7510343906, 7766459469, 7723, 2895072059, 7832740507, 2081231771, 7535692621, 7759125371, 2037586757, 2080682571, 7973370494, 7927918744, 1513568815, 1233542743, 7596296183, 1182181633, 1217900373, 7473681922, 2045799370, 7951487214, 2045869928, 7951487214, 1792862369, 1904938787, 2080682571, 2080891069, 7460302298, 1292876023, 1895247247, 1236725197, 7849493509, 1329829990, 1212258744, 7549100631, 7842489565, 1955621599, 7927901432, 1530561262, 8451341497, 7851951672, 2035970994, 1416286681, 1416288797, 1183540598, 63366, 1204806805, 1709248876, 2045793759, 2045688662, 3338888888,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988499740
- Pageviews today : 670140
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
1908300280
+441908300280
auto dealers mvm south wirral merseyside
Scam call about domain names and services
Frozen food mccallums prepacked foods
This number was left on my phone who is it
Electrical Engineers and Contractors Engineering Projects Development Ltd St Helens Merseyside
Receptionist calling to cancel a medical appointment due to staff absence - legitimate.
audio visual services scallop films plc (London)
Bangor
driving schools carmyle driving centre ltd
business transfer agents harris & co. Manchester manchester
dentists t zaki (London)
pennysave beautycraft - toiletries Wakefield
homeweb cullompton k business services
industrial consultants kayjay associates romsey hampshire
pallets crates and packaging imperial packing services (London)
david ian gillies - accountants Wakefield
harassment
places of worship st Margarets parish church
solicitors noel starke and co crawley
cornish celtic knitwear st ives d manufacturing
2 sisters food products ltd meat products west bromwich b70 0sz
stone merchants s m stone sales todmorden lancashire
garages new park garage (southampton) ltd southampton hampshire
estate agents bradleys estate agents exeter
goes silent then some foreign woman starts wittering on
This arse bandit just called.
07950431683- Automated voice claiming to be HMRC, Basically saying that I need to calling them or I will be in trouble. Its a load of Bulshit. Bog fat ass scam.
chiropractors west london choropractic clinic (London)
h williamson & son - commercial cleaning services Brighouse
Had a call from 01382250087 stating that he was doing a Health Service survey regarding arthritis, well this is a new one, so hung up
vallance ltd leeds 2462
cafes and tea rooms le petit pain (scotland) ltd
lakeland cottage holidays
clothing - general dressmaster u k (London)
pitney bowes hatfield hertfordshire
had a call from this number Wanted me to invest money in wine with a good returns.Was rather cagey about the whole deal
smart meters no no No!
London
exhibition services hardial ltd (London)
Computers O M N I Digital (U K) Ltd. Harlow
guttering services alpine gutters
Debt management
Recorded message saying that call was from HMRC doing an investigation, please contact- unlikely so assume it is a SCAM
23 Nov 2021 - Just had a call from this number, but didn't answer as I was on another call. Good to know it was probably a suspicious call.Reply
places of interest rydal mount & gardens ambleside cumbria
battery suppliers shield batteries (London)
stiell process engineering ltd glasgow k business services
waddington & ledger ltd - printers Elland
apache components stevenage
avonew precision engineering ltd aircraft components birmingham b12 1tb
london industrial supplies ltd london construction
unisex hairdressers lafayette southampton hampshire
fairdeal private hire - mini cabs Leeds
London stock
unisex hairdressers john cardiff lancaster lancashire
police and support services kidsgrove police station stoke on trent
Automated call telling me my internet connection will terminate in 24 hours. Press 1 to resolve the problem.
dahl and dahl great missenden recreational, cultural and sporting activities
Services
Sunday 13.48 got a call asking ot speak to somone that mved away from this house oever a year ago. When I called back to see where they were calling from the answer machineg said GNSK doing a survey.
c q s ltd worcester other business activities
Accident
restaurants pap's fish restaurant (London)
SCAM / SPAM
ambulance chaser
technical supplies ltd london
trimmers and trimmings - manufacturers kersen trimmings (London)
It is a genuine number AXA insurance but i missed the call - it was authorised by me as I had performed an online insurance quote with them the previous night.
ifield car sales auto dealers crawley rh11 0ex
potteries diesel ltd stoke on trent manufacture of motor vehicles,trailers and semi trailers
Positive number
Safe number
tv, video and film granada home technology lymington hampshire
constantly call
st johns rc aided first school alnwick education
charities and voluntary organisations national pet week (London)
advertising agencies mayhew harper mccrea (London)
Basildon
pubs bars and inns jay tees
Number not recognised when you dial back. Spam
election views
dolphin foods supermarkets birmingham b24 8eh
medicines and therapies biotech health and nutrition andover hampshire
Fraud
Pontefract
energy conservation consultants isl associates (London)
Mohiuddan Malik - total con man from builders and plumbers company
Places of Worship St David C Of E Church Leigh On Sea
exhausts and shock absorbers brighton tyres & exhausts brighton
Caller claims to have money from a PPI on your credit card
fishing for recent car accidents
fabaloy (southern) ltd access equipments haslemere gu27 1yl
Called Sainsbury’s Bank they could not confirm this number. Spoke to fraud who also could not confirm. They said it might be but couldn’t be sure
Tshirts - General Bodyprint Leigh-on-Sea
delivery services amtrack express parcels
Rang but no message left.
china and glassware - retail thomas goode & co ltd (London)
party organisers the jonathan seaward organisation ltd (London)
Call to confirm delivery of mattress
Cold call scam call saying you have won free lines on lottery