1473460640 (01473460640)
Who called me from phone number 1473460640 Ipswich
Who called me from 1473460640
Phone number 1473460640 it's a landline number from Ipswich. This phone number has been searched 1 times. The first search was on 2026-02-20 09:54:59 and the last on 2026-02-20 10:55:59. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1473460640 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+441473
Phone number 1473460640 - 0 opinions
Reviews for phone number 1473460640
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1473460640
QR Codes for number +44 1473460640




Phone number 1473460640 (+441473460640)
Country: United Kingdom
Country code: +44 (0044)
City: Ipswich
Directional local: 1473 (01473)
Code: 441473 (00441473)
This number was searched 1 times
First date of search: 2026-02-20 09:54:59
Date of last check of this number: 2026-02-20 10:55:59
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 460643741
A similar number: 14734610, 14734611, 147346960, 147346805, 147846064, 147846064, 149646064, 149346064(14 73 46 10,14 73 46 11,14 73 46 960,14 73 46 805,14 78 46 064,14 78 46 064,14 96 46 064,14 93 46 064)
Previous phone numbers: 1473460639 1473460638 1473460637 1473460636 1473460635 1473460634 1473460633 1473460632 1473460631 1473460630 1473460629 1473460628 1473460627 1473460626 1473460625 1473460624 1473460623 1473460622 1473460621 1473460620 1473460619 1473460618 1473460617 1473460616 1473460615 1473460614 1473460613 1473460612 1473460611 1473460610 1473460609 1473460608 1473460607 1473460606 1473460605 1473460604 1473460603 1473460602 1473460601 1473460600 1473460599 1473460598 1473460597 1473460596 1473460595 1473460594 1473460593 1473460592 1473460591 1473460590 1473460589 1473460588 1473460587 1473460586 1473460585 1473460584 1473460583 1473460582 1473460581 1473460580 1473460579 1473460578 1473460577 1473460576
Next phone numbers: 1473460641 1473460642 1473460643 1473460644 1473460645 1473460646 1473460647 1473460648 1473460649 1473460650 1473460651 1473460652 1473460653 1473460654 1473460655 1473460656 1473460657 1473460658 1473460659 1473460660 1473460661 1473460662 1473460663 1473460664 1473460665 1473460666 1473460667 1473460668 1473460668 1473460669 1473460670 1473460671 1473460672 1473460673 1473460674 1473460675 1473460676 1473460677 1473460678 1473460679 1473460680 1473460681 1473460682 1473460683 1473460684 1473460685 1473460686 1473460687 1473460688 1473460689 1473460690 1473460691 1473460692 1473460693 1473460694 1473460695 1473460696 1473460697 1473460698 1473460699 1473460700 1473460701 1473460702 1473460703 1473460704 1473460705 1473460706 1473460707 1473460709 1473460709 1473460710
(Previous phone numbers: 01473460639 01473460638 01473460637 01473460636 01473460635 01473460634 01473460633 01473460632 01473460631 01473460630 01473460629 01473460628 01473460627 01473460626 01473460625 01473460624 01473460623 01473460622 01473460621 01473460620 01473460619 01473460618 01473460617 01473460616 01473460615 01473460614 01473460613 01473460612 01473460611 01473460610 01473460609 01473460608 01473460607 01473460606 01473460605 01473460604 01473460603 01473460602 01473460601 01473460600 01473460599
Next phone numbers: 01473460641 01473460642 01473460643 01473460644 01473460645 01473460646 01473460647 01473460648 01473460649 01473460650 01473460651 01473460652 01473460653 01473460654 01473460655 01473460656 01473460657 01473460658 01473460659 01473460660 01473460661 01473460662 01473460663 01473460664 01473460665 01473460666 01473460667 01473460668 01473460668 01473460669 01473460670 01473460671 01473460672 01473460673 01473460674 01473460675 01473460676 01473460677 01473460678 01473460678 01473460679)
+44 01473460640 reviews
Add your opinion about +441473460640
UK 1473460640
price mobile phones
Who called from number 1473460640
You can rate other simmilar phone numbers from Ipswich, searched in our database
| 1473432511 | 1473472324 | 1473483368 |
| 1473393125 | 1473667448 | 1473490303 |
Random searched phone numbers
| 894 292 1010 | 759 314 9787 | 378 685 5272 |
| 653 926 0594 | 533 374 1513 | 553 910 2180 |
Top rated phone numbers
1752360114 phil bennellick plymouth devon1216583794 car accident scammer
1484401636 h williamson son - commercial cleaning services Brighouse
2084322975 Fejvadaacutesz ha munkaacutet keresel vedd fel
7775813625 SCAM
1142436007 b m w construction sheffield d manufacturing
7739807681 martyn fleetwood northampton northamptonshire
1822854386 tv video and radio yelverton television services yelverton
1618182458 Fraud dont accept
7395873034 Fraud HMRC scammer based in UK
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
1335344182 d w weaver ashbourne other supporting land transport activities
2089776540 general stores - retail chandhok stores London
1417632920 Arnold Clarke Mount Florida
1216445007 performances birmingham ltd birmingham west midlands
2080028706 A English number as I dont know anyone from there or who is on holidays over their guessing its another annoying we want money call
1337827093 electrical engineers and contractors ian bruce
2087493388 typesetters - print word setting group London
2036345688 Waste of time
2074995455 financial consultants j g ravandi London
2070482370 Rang constantly regarding a car accident I havent had didnt know my name and when told the information was incorrect changed to a medical neglect claim Very abusive
2890491981 ormeau pharmacy chemists and pharmacists belfast ulster
2072533675 florists - retail j j mack London
9015452989 SCAMThis number appeared on my Bill 645 for 7 seconds
2074992823 china and glassware - retail thomas goode co ltd London
1613746956 A company looking at Lifestyle habits not able to take no for an answer ie stop calling me get me off your list Very rude agent potentially dodgy company
1722322682 salisbury antique dealers nicholas antiques
7595303052 Stafford
7498498023 SCAM
1744613333 electrical goods s e s liverpool liverpool merseyside
Number popularity chart 1473460640
Your opinion about telephone number 1473460640 (147 346 0640)
Who called from 01473460640?: Called Ipswich ??? Your information about who called from number 01473460640 to you will be stored in our database of landline and mobile numbers. Sharingmessage with other users can prevent many threats or form positive feedback on subject of a given telephone or company number. Warning of others about the risks of receiving dangerous and paid phone calls is now an important piece of information that you can use protect against fraud or extortion resulting from high telecommunications fees among others for calling back, writing an SMS, answering a telephone. Maybe somebody called on a loan or a loan, payday or on third party insurance or flat insurance. Someone could also call from a bank or debt collection. Price mobile phones. Someone could have contacted the hotel regarding a vacation or holiday, from a service company regarding the service ordered, or called a courier with a parcel to be delivered purchased on the allegro or online store. From what network he called to me?
Possible number records of 01473460640 01473-460-640
+441473460640 |
00441473460640 |
1473 460 640 |
14 73 46 064 0 |
147 34 60 64 0 |
14-73-46-064 0 |
0044 1473-460-640 |
00 44 147 34 60 640 |
(+44)1473460640 |
14 73 46 064 0 |
(14) 7346 064 0 |
00 44 (14)7 34-60-64-0 |
+441473460640 In words... 147 346 0640
one thousand four hundred seventy three four hundred sixty six hundred forty |
one four seven three four six zero six four |
Possible number records of 1473460640
Last rated phone numbers
1212850415, 7471790045, 1704791755, 2035236404, 2045870360, 7476254252, 1493759152, 1636705623, 2085744053, 918422052901, 7476254258, 7899240499, 2045711357, 2045256899, 1514534244, 1644216568, 7754920968, 44775107795, 120461121, 1442392324, 7741293282, 2031293300, 7908670414, 7401932396, 1189422010, 2080560783, 2045711342, 7803471903, 1260591147, 1296711109, 1615452042, 1234632191, 2045796687, 7949188795, 8008021456, 7340287161, 7926771721, 1617186104, 1235627615, 8458520770, 1206805914, 132437153, 7477189744, 1257470647, 1257470647, 7700169047, 7500124751, 7359322717, 3156325794, 1330567147,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988496659
- Pageviews today : 667059
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
1473460640
+441473460640
the car valeting co weybridge sale,maintenance and repair of motor vehicles
nuisance
armstrong bell london k business services
the bosuns locker south queensferry
Called 3 times in two days, 17 & 18 Aug 2015, about my computer. I said I was being harrassed and asked to speak to manager, and the speaker rang off.
Haven't answered. Can't be bothered to listen to some sales patter. They call every day though and my phone wont let me block the number... irritated!!
auto dealers mvm south wirral merseyside
newsagents - retail w & g semple lytham st. Annes lancashire
clayton construction ltd weston super mare erection of roof covering and frames
autodrive car and van hire
Eye Hospital. But fax machine when called them back.
home housing association ltd wetherby health and social work
menswear delirious co ltd exeter
Automated call Repetitive call. I hang up before finding out who it is.
finham library libraries - book coventry cv3 6ep
dentists elfyn samuel - Llanelli
supermarkets lords food & wine (London)
rothery m.j mcsp srp private clinics midhurst gu29 9dr
benfield junior school brighton m education
Automated call, no one one other end of line, some music/tone played then hung up. No voicemail left
dahl and dahl great missenden recreational, cultural and sporting activities
Friend had somebody phone her and ask her to log into her account .... very suspicious call - clearly trying to hack info and definitely NOT BT :-(
Coach Hire Wards Coaches Colchester
Call regarding windows. I requested they remove my details from the system and they continue to ask for my dad. This is how i know it's a sales call
SCAM
Financial Advisers Brents of Brentwood Ltd. Brentwood
toad security runcorn d manufacturing
kielder multilingual media kielder connections ltd epsom
Bloody ripoff was told I would have money in my account guaranteed 48hr they charged me 47 quid it s been 2 weeks and still nothing i ring them everyday all they tell me is defiantly will ring me today DONT TRUST THEM
places of worship victoria baptist church eastbourne
florists - retail rosies florist (London)
this number rang me told me they were Scottish gas and said that my dad had gave my number in a shopping centre when I told them I doubt that cause my dad don't go shopping and he would t give my number out she laughed and hung up
garages - repair and modification batty & oliver barnsley
unsolicited call
Clubs and associations skewen rugby football & social club - Neath
do not answer
motorcycles - general performance motor cycle services darwen lancashire
servocell ltd harlow other business activities
Called twice after 9-00am and left no message.
plumbing and heating c g barker plumbing and heating winchester hampshire
Criminal fraudsters trying to scam money for terrorism.
take away canton take away (London)
commercial vehicle dealers barnes of shoreham shoreham-by-sea
social services child & family disabilities - Swansea
SCAM phoned to tell me my NI number had been cancelled due to illegal activity. If I didn’t respond by the end of the day the police would be around to arrest me!!
Rate 6 annoying!
Calling to check on Domain setup progress and try to upsell some items.
pubs, bars and inns elizabeth ii bognor regis
Theatres and Concert Halls Isle of Wight Theatres Ltd Shanklin Isle of Wight
Computers O M N I Digital (U K) Ltd. Harlow
44749586667
firework emporium ipswich retail trade, except of motor vehicles
Dentists marchment dental care
If you answer or ring back call costs 5 pounds
systems & services computer systems and software croydon cr0 3ex
Have had called from 7 different variations on 0161 503.... same company calling just from different numbers. Advise if any number starting 0161 503 should just be blocked straight away. After 7th call told them I wasn’t who they were looking for. See how long it lasts
Block them. It's time this was illegal.
v whitehouse unisex hairdressers rowley regis b65 0ea
citizens advisory?
camping sites upper lynstone camping & caravan park bude
nursing homes eastyne home for the elderly worthing
Automated message, alleging credit card fraud - assumed phishing
aluminium stockholders pro-lam ltd haywards heath
Pubs, Bars and Inns The Prince of Wales Chelmsford
caterers carousel catering (cannock) ltd cannock
spice publishing services ltd london publishing and media
virgin megastore record, tape and cd crawley rh10 1ff
Romsey
Didn’t answer, called me times today
Capital One Fraud Department for unusual activity on your account
financial consultants claywood financial services ltd (London)
pubs bars and inns bainsford bar
say yes to training pontypridd adult and other education not elsewhere classified
daniel mckay dairies ballymoney county antrim
mirrors and decorative glass - retail b & m sales (London)
London stock
reigate grammar school
florists - retail j j mack (London)
first point financial planning ltd banstead act auxilliary financial intermediation
pubs bars and inns dublin packet inn - Holyhead
Bracknell
none london essex
bromsgrove caravans bromsgrove
Timber merchants importers and agents james jones & son
Telemarketing
power dialing doesn't ring long enough to answer. now blocked.
Clipped message stating that if I didn't get in contact with them immediately they would decline my card, they did not say who they were or who they wanted to speak to but seeing as the call originated in Italy, it is a Scam
benefits for all
datalinx ltd - network and data communications Elland
Salford
television video and radio repair c & c video production (London)
Edinburgh
libraries (west sussex county council) chichester recreational, cultural and sporting activities
hebridean brewing co stornoway manufacture of food products and beverages
glass merchants t a anders & co. Ltd. Salford lancashire
London
olympus welding and industrial supplies grimsby d manufacturing
cfh creative communications ltd burnley 7440
Other people said thus was nuisance
village beauty beauty saloons epsom kt17 1nx