1753613041 (01753613041)
Who called me from phone number 1753613041 Slough
Who called me from 1753613041
Phone number 1753613041 it's a landline number from Slough. This phone number has been searched 2 times. The first search was on 2026-02-17 04:44:12 and the last on 2026-02-20 10:57:23. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1753613041 Trust level
100 %
Ranking:
Searched:
2
First search:
2026-02-17
Directional:
+441753
Phone number 1753613041 - 0 opinions
Reviews for phone number 1753613041
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1753613041
QR Codes for number +44 1753613041




Phone number 1753613041 (+441753613041)
Country: United Kingdom
Country code: +44 (0044)
City: Slough
Directional local: 1753 (01753)
Code: 441753 (00441753)
This number was searched 2 times
First date of search: 2026-02-17 04:44:12
Date of last check of this number: 2026-02-20 10:57:23
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 403163571
A similar number: 175361922, 175361838, 175361218, 175361354, 171561304, 171561304, 173761304, 171861304(17 53 61 922,17 53 61 838,17 53 61 218,17 53 61 354,17 15 61 304,17 15 61 304,17 37 61 304,17 18 61 304)
Previous phone numbers: 1753613040 1753613039 1753613038 1753613037 1753613036 1753613035 1753613034 1753613033 1753613032 1753613031 1753613030 1753613029 1753613028 1753613027 1753613026 1753613025 1753613024 1753613023 1753613022 1753613021 1753613020 1753613019 1753613018 1753613017 1753613016 1753613015 1753613014 1753613013 1753613012 1753613011 1753613010 1753613009 1753613008 1753613007 1753613006 1753613005 1753613004 1753613003 1753613002 1753613001 1753613000 1753612999 1753612998 1753612997 1753612996 1753612995 1753612994 1753612993 1753612992 1753612991 1753612990 1753612989 1753612988 1753612987 1753612986 1753612985 1753612984 1753612983 1753612982 1753612981 1753612980 1753612979 1753612978 1753612977
Next phone numbers: 1753613042 1753613043 1753613044 1753613045 1753613046 1753613047 1753613048 1753613049 1753613050 1753613051 1753613052 1753613053 1753613054 1753613055 1753613056 1753613057 1753613058 1753613059 1753613060 1753613061 1753613062 1753613063 1753613064 1753613065 1753613066 1753613067 1753613068 1753613069 1753613069 1753613070 1753613071 1753613072 1753613073 1753613074 1753613075 1753613076 1753613077 1753613078 1753613079 1753613080 1753613081 1753613082 1753613083 1753613084 1753613085 1753613086 1753613087 1753613088 1753613089 1753613090 1753613091 1753613092 1753613093 1753613094 1753613095 1753613096 1753613097 1753613098 1753613099 1753613100 1753613101 1753613102 1753613103 1753613104 1753613105 1753613106 1753613107 1753613108 1753613110 1753613110 1753613111
(Previous phone numbers: 01753613040 01753613039 01753613038 01753613037 01753613036 01753613035 01753613034 01753613033 01753613032 01753613031 01753613030 01753613029 01753613028 01753613027 01753613026 01753613025 01753613024 01753613023 01753613022 01753613021 01753613020 01753613019 01753613018 01753613017 01753613016 01753613015 01753613014 01753613013 01753613012 01753613011 01753613010 01753613009 01753613008 01753613007 01753613006 01753613005 01753613004 01753613003 01753613002 01753613001 01753613000
Next phone numbers: 01753613042 01753613043 01753613044 01753613045 01753613046 01753613047 01753613048 01753613049 01753613050 01753613051 01753613052 01753613053 01753613054 01753613055 01753613056 01753613057 01753613058 01753613059 01753613060 01753613061 01753613062 01753613063 01753613064 01753613065 01753613066 01753613067 01753613068 01753613069 01753613069 01753613070 01753613071 01753613072 01753613073 01753613074 01753613075 01753613076 01753613077 01753613078 01753613079 01753613079 01753613080)
+44 01753613041 reviews
Add your opinion about +441753613041
UK 1753613041
best value android phone
Who called from number 1753613041
You can rate other simmilar phone numbers from Slough, searched in our database
| 1753638241 | 1753672422 | 1753684724 |
| 1753451990 | 1753686235 | 1753869058 |
Random searched phone numbers
| 894 572 8784 | 621 328 5712 | 651 419 4068 |
| 378 538 9478 | 161 483 3953 | 101 381 4516 |
Top rated phone numbers
1472353373 olympus welding and industrial supplies grimsby d manufacturing1273818702 china and glassware - retail the edinburgh crystal glass co brighton
7595303052 Stafford
2071389073 Rude rs34013 Some sort of financial stuff threatened me with a fine for wasting the companys time In breech of GDPR
2921680594 Thanks posters now blocked
3332427547 SPAM
2086477850 robins newsagents retail wallington sm6 9bn
1926484230 Warwick
1274500390 Another Talktalk scam phone call Called off when I mentioned TPS
1580200516 fish merchants j standen wadhurst
2084260247 accountants chempney myers London
1744613333 electrical goods s e s liverpool liverpool merseyside
2087484778 fashion shops barons court fashion London
2088869357 restaurants paps fish restaurant London
2070890359 went silent then put phone down
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
2076004032 London
1978860976 cafes and tea rooms cottage tea rooms - Llangollen
7804537543 another compensation offer for my imaginary accident boring boring boring
2038131615 Looks like serious scammers trying to scare you into NI number de-activation and court
1579363301 shooting ground liskeard recreational cultural and sporting activities
1924281587 pennysave beautycraft - toiletries Wakefield
1313436807 lackie and co edinburgh k business services
1622671300 ask italian maidstone
2089957038 Fraud
2082928440 estate agents northside agencies London
1702523126 Places of Worship St David C Of E Church Leigh On Sea
1423522122 galloway antiques fairs harrogate other business activities
1824703234 Mixed crops I l h d jones - Ruthin
1784252926 Called from this number by someone who sounded very Indian claiming to be from internet provider TalkTalk I m not with themIt turned out to be the wwwteamviewercom wwwsupportme scam where they claim something is wrong with your computer they never tell you what They then ask if there are lights flashing on your router - they should of course but they pretend that indicates a faultI led them quite a dance for an hour and a half before getting fed up with struggling to understand their
Number popularity chart 1753613041
Your opinion about telephone number 1753613041 (175 361 3041)
Who called from 01753613041?: Who called from UK Slough ??? Who is calling from 01753613041?? On our site a very transparent way you will check the location of an unknown phone number as well as see the location on the map I check from what city was the connection I check the ranking of the given number his opinion comments and statistical data among others How many times a given Number unknown number was searched for how many views when was the first search date and when was the last search date of this phone number. Don't risk additional costs by calling or receiving a call from an unknown phone number. Always try to check unknown connections by phone numbers you have not seen or do not know yet. It is safe here to check the phone numbers in our database and on other websites. Best value android phone. Tell your friends about our site and let me know that they can check every unknown number in our number database for free at any time at any time. We invite you to check phone numbers and add opinions.
Possible number records of 01753613041 01753-613-041
+441753613041 |
00441753613041 |
1753 613 041 |
17 53 61 304 1 |
175 36 13 04 1 |
17-53-61-304 1 |
0044 1753-613-041 |
00 44 175 36 13 041 |
(+44)1753613041 |
17 53 61 304 1 |
(17) 5361 304 1 |
00 44 (17)5 36-13-04-1 |
+441753613041 In words... 175 361 3041
one seven five three six one three zero four |
seventeen fifty three sixty one thirty forty one |
Possible number records of 1753613041
Last rated phone numbers
7745268386, 7536211388, 7742665280, 7512602075, 7728320673, 7545437254, 7466888519, 7728320673, 1243553951, 2037691834, 7709595718, 2922722090, 7964986532, 7359860140, 1644216392, 1803605359, 2045792453, 919229043193, 2045385434, 7704045454, 7921645711, 1913891632, 1619647939, 3303413407, 7812468297, 1494675111, 1902504285, 3303413046, 7391188080, 7565827573, 794326956, 2045381051, 1505287992, 2034249677, 7822000181, 7980876918, 7496033634, 1156461231, 7731317244, 1622419732, 7388, 3308182770, 1158775185, 7340675559, 3303413046, 3450130151, 2034107527, 1313812776, 1357333036, 7467321303,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988498699
- Pageviews today : 669099
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
1753613041
+441753613041
Zurich Prime
Mohiuddan Malik - total con man from builders and plumbers company
020 3318 6524
blythe neighbourhood council london activities of membership organisations nec
g-mat moulding automation technologies ltd automation systems coventry cv7 9jy
Claimed to be from a savings company I've never heard of and said they get your number from various sources including telemarketing and competition entries. I don't enter competitions or deal with telemarketing of any sort. 2nd call of the morning. Now Blocked.
madeley computer systems ltd dudley
Silent call several calls today all starting 077010 all silant when i picked up.
Hloo dady jan
clubs and associations bafta
unkown , outside london didnt leave msg
Safe number
British Gas
engineers h rothwell & co. Ltd. Rochdale lancashire
Say and they keep ringing back
fashion shops weatherwise clothing birkenhead merseyside
Bangor
This number called me twice today while I was at work, no information on the number anywhere. Area code was the code for my area so wondered who it could be. Called again while ...
SCAM about suspicious activity on landline. Would be disconnected and instructed to press 1 on keypad.
reigate grammar school
Edinburgh
Tried to tell me I need to speak to them about my amazon bill (I don't have one).
career guidance haggerston pharmacy (London)
Hearing Aids Hidden Hearing Ltd Whitley Bay Tyne and Wear
wines spirits and beer - retail unwins wine merchants (London)
travel agents lunn poly ltd. Rochdale lancashire
plumb center plumbers merchants horsham rh12 4st
barnes & sherwood (trustee) ltd. Actuaries woking gu21 5jl
silent caller
nuisance
Garages - Repair and Modification Smart Lane Motor Repairs & Accident Repairs Centre Loughton
don't no the number
London
workforce ltd beverley education
Doncaster
Castletown
town planning consultants metropolitan transport research unit (London)
Leicester
RSPCA Call Centre
scam about a car accident I was supposed to be involved in. think it computer generated
Telemarketing
brs ltd warwick renting machinery and equipment
Scam call about domain names and services
men's hairdressers the abbey barber shop torquay
Ppm scam. Automated call.
Called to my mobile, did not answer it then checked online, I only ever give out a mobile number now and receive very few calls. Called the number back but just got an automated message asking me to hold while they put me through to an agent. No company na
North Shields
power dialing doesn't ring long enough to answer. now blocked.
technical and agricultural colleges london esthetique (education) ltd (London)
a.c elsbury screen process printers farnham gu10 5rj
Paid number
nanny agencies primary placement childcare agency (London)
This arse bandit just called.
mobile calls 10 per day 02390448059 ask my name then hang up
No idea rang twice & cut off
SCAM 2ND CALL TODAY FROM AMAZON - DIFFERENT NUMERS. SAYING SOMEONE HAD ORDERED AN IPHONE FROM MY ACCOUNT. FIRST CALL IT WAS £500 - 2ND CALL £730.. HUNG UP.... CHECKED IT OUT WITH AMAZON & DEFINATE SCAM OTHER NUMBER WAS 07986 209690- BOTH TO LANDLINE
business link leicestershire leicester business and management consultancy activities
sports goods shops h sports - Swansea
RTC call.... hung up.
s o s hull manufacture of other office and shop furniture
I ignored call and checked number on here. I am getting these calls purporting to be talktalk. I was with them but now with sky.Be aware they are also ringing me using a mobile number.Elderly family friend got caught and logged on to her PC as they suggest
funeral services nichols stafford
activenetdesign ltd street
central government the probation service - Bargoed
hospitals west wales general hospital - Carmarthen
lackie and co edinburgh k business services
opus professional
carshalton electrical services television, video and radio repair carshalton sm5 2dw
doctors general practitioners o p shrivastava rotherham
SCAM This number appeared on my Bill £6.45 for 7 seconds
photographic processors foto processing bolton lancashire
Rang off when I answered
home housing association ltd wetherby health and social work
Keep ringing to undertake a survey, despite being told not to less and less politely. When asked not ring, the response is We will after you take the survey
matrix grinding technologies birmingham
Car Engine Specialists J H Autos Romford
Chemists and pharmacists abbey health care - Aberdovey
laughing dog products pet foods rugby cv23 9ln
advertising services spirit integrated communications ltd (London)
wedding services vintage & classic car restoration heathfield
marketing consultants linden marketing associates lichfield
insurance agents and companies hill house hammond ltd ashford
dennis c lawrence builders lingfield rh7 6jg
religious organisations clc international sheffield
garment designers quiver (London)
Hi, just via email and the dating site. A familiar life story regarding wife n daughter so was suspicious. Way over the top considering only a couple of emails...life together etc. French Canadian now near Glasgow...in France at the mo for inspiration for his art as having an exhibition next year. Industrial architect retired.
greenway electronic products ltd sutton
florists - retail natrel fleur liverpool merseyside
Scottish power unsolicited call
commercial cleaning services initial hospital services
chauffeur driven cars location cars ltd (London)
profile management and specialist recruitment ltd
reed computing personnel bristol
collexion catalogue goods general stores household newry county down
Called Sainsbury’s Bank they could not confirm this number. Spoke to fraud who also could not confirm. They said it might be but couldn’t be sure
Civil engineers g w j joinery contractor - Llangollen
phoned me 7 times today !!!!!!!
japanese translating norwich k business services
doctors general practitioners shepherd, m a w st leonards on sea
jewellers roy charles