2392400864 (02392400864)
Who called me from phone number 2392400864 Portsmouth / Southampton
Who called me from 2392400864
Phone number 2392400864 it's a landline number from Portsmouth / Southampton. This phone number has been searched 1 times. The first search was on 2026-02-20 09:49:14 and the last on 2026-02-20 10:50:14. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
2392400864 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+4423
Phone number 2392400864 - 0 opinions
Reviews for phone number 2392400864
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 2392400864
QR Codes for number +44 2392400864




Phone number 2392400864 (+442392400864)
Country: United Kingdom
Country code: +44 (0044)
City: Portsmouth / Southampton
Directional local: 23 (023)
Code: 4423 (004423)
This number was searched 1 times
First date of search: 2026-02-20 09:49:14
Date of last check of this number: 2026-02-20 10:50:14
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 680042932
A similar number: 239240169, 239240353, 239240439, 239240993, 239340086, 239340086, 239040086, 231540086(23 92 40 169,23 92 40 353,23 92 40 439,23 92 40 993,23 93 40 086,23 93 40 086,23 90 40 086,23 15 40 086)
Previous phone numbers: 2392400863 2392400862 2392400861 2392400860 2392400859 2392400858 2392400857 2392400856 2392400855 2392400854 2392400853 2392400852 2392400851 2392400850 2392400849 2392400848 2392400847 2392400846 2392400845 2392400844 2392400843 2392400842 2392400841 2392400840 2392400839 2392400838 2392400837 2392400836 2392400835 2392400834 2392400833 2392400832 2392400831 2392400830 2392400829 2392400828 2392400827 2392400826 2392400825 2392400824 2392400823 2392400822 2392400821 2392400820 2392400819 2392400818 2392400817 2392400816 2392400815 2392400814 2392400813 2392400812 2392400811 2392400810 2392400809 2392400808 2392400807 2392400806 2392400805 2392400804 2392400803 2392400802 2392400801 2392400800
Next phone numbers: 2392400865 2392400866 2392400867 2392400868 2392400869 2392400870 2392400871 2392400872 2392400873 2392400874 2392400875 2392400876 2392400877 2392400878 2392400879 2392400880 2392400881 2392400882 2392400883 2392400884 2392400885 2392400886 2392400887 2392400888 2392400889 2392400890 2392400891 2392400892 2392400892 2392400893 2392400894 2392400895 2392400896 2392400897 2392400898 2392400899 2392400900 2392400901 2392400902 2392400903 2392400904 2392400905 2392400906 2392400907 2392400908 2392400909 2392400910 2392400911 2392400912 2392400913 2392400914 2392400915 2392400916 2392400917 2392400918 2392400919 2392400920 2392400921 2392400922 2392400923 2392400924 2392400925 2392400926 2392400927 2392400928 2392400929 2392400930 2392400931 2392400933 2392400933 2392400934
(Previous phone numbers: 02392400863 02392400862 02392400861 02392400860 02392400859 02392400858 02392400857 02392400856 02392400855 02392400854 02392400853 02392400852 02392400851 02392400850 02392400849 02392400848 02392400847 02392400846 02392400845 02392400844 02392400843 02392400842 02392400841 02392400840 02392400839 02392400838 02392400837 02392400836 02392400835 02392400834 02392400833 02392400832 02392400831 02392400830 02392400829 02392400828 02392400827 02392400826 02392400825 02392400824 02392400823
Next phone numbers: 02392400865 02392400866 02392400867 02392400868 02392400869 02392400870 02392400871 02392400872 02392400873 02392400874 02392400875 02392400876 02392400877 02392400878 02392400879 02392400880 02392400881 02392400882 02392400883 02392400884 02392400885 02392400886 02392400887 02392400888 02392400889 02392400890 02392400891 02392400892 02392400892 02392400893 02392400894 02392400895 02392400896 02392400897 02392400898 02392400899 02392400900 02392400901 02392400902 02392400902 02392400903)
+44 02392400864 reviews
Add your opinion about +442392400864
UK 2392400864
free call online
Who called from number 2392400864
You can rate other simmilar phone numbers from Portsmouth / Southampton, searched in our database
| 2392425220 | 2392450764 | 2392480137 |
| 2392975684 | 2392848627 | 2392725290 |
Random searched phone numbers
| 547 160 0882 | 400 554 1951 | 980 800 2575 |
| 886 143 8865 | 810 571 8925 | 282 922 936 |
Top rated phone numbers
1754880371 wainfleet magdalen primary school skegness education2036349913 Rang ansa mc 18h25 on 30JAN17 Did not leave message
1375391313 orourke group ltd grays 4521
8700119076 the roebuck inn stevenage h hotels and restaurants
1444456946 SCAM caller claimed to be from Microsoft When I said I didnt have a computer he hung up
2087493388 typesetters - print word setting group London
1293440995 ifield car sales auto dealers crawley rh11 0ex
1142722222 funeral services john heath sons sheffield
803598039 8
1236822081 doctors general practitioners hardie m
1786477800 regular call trying to sell insurance
1482841842 HULL
1613932524 Fraud
1264790463 andover indian moghul tandoori restaurant
1517288299 secondhand shops vale home care liverpool merseyside
163535052 newbury service station newbury g wholesale and retail
2089611614 fabric suppliers hallbridge ltd London
1202575710 restaurants tamarin holdings ltd bournemouth dorset
7899894138 SCAMRecorded message about renewing my Amazon subscription for 3999 Press 1 to cancelI hung up before being charged or otherwise fleeced by this scammer
2380814486 industrial consultants kayjay associates romsey hampshire
1537927208 SCAM Pretending to be from SKY refunding me some overpaid money and wanting my details
1212362356 alabaster wilson ltd jewellery design birmingham b1 3ld
1992470060 microfilming services micro imaging services ltd London
2076710242 Fraud
7450068566 london
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
1324300401 Similar number 1324300406 is already reported here with PPI - probably this one is the same case same call centre I dont answer unknown numbers and they left no message Have missed calls from them on my mobile was trying to dig some info on the internet before calling them back but found nothing no luck People pls did someone answer this number who is it
1737222231 reigate grammar school
1752892637 livestock and others francis edward maddock ivybridge
1295983453 blocked
Number popularity chart 2392400864
Your opinion about telephone number 2392400864 (239 240 0864)
Who called from 02392400864?: Called Portsmouth / Southampton ??? Add your opinion about this phone number, maybe you know who called from number 2392 400 864? Maybe it's yours phone number and you can comment on it. Please rate if this phone number is secure and you can pick up this phone. If someone called you from this phone number, someone called or sent you some paid SMS, please add your opinion on our website. Free call online. Do not keep the information who called only for myself. Share the description and your opinion on the description of your experience with this number phone, use our form and help other our users. Please rate this phone number (+44 023 92 40 086) is it a secure number and you can answer the call. Thank you for yoursreviews.
Possible number records of 02392400864 02392-400-864
+442392400864 |
00442392400864 |
2392 400 864 |
23 92 40 086 4 |
239 24 00 86 4 |
23-92-40-086 4 |
0044 2392-400-864 |
00 44 239 24 00 864 |
(+44)2392400864 |
23 92 40 086 4 |
(23) 9240 086 4 |
00 44 (23)9 24-00-86-4 |
+442392400864 In words... 239 240 0864
two thousand three hundred ninety two four hundred eight hundred sixty four |
two billion three hundred ninety two millions four hundred thousand eight hundred sixty four |
Possible number records of 2392400864
Last rated phone numbers
2031487678, 8442843421, 7591335998, 1285332633, 2037810895, 1422774506, 1618189743, 7548881046, 1329558540, 1902937418, 1235627887, 7458030387, 7984162540, 2080495903, 1515257555, 7399183893, 1135349146, 7404665257, 7702519784, 1442255422, 1822874751, 7477458572, 2921280155, 7553324573, 1214681657, 1324232034, 1827216401, 7482766278, 7932213339, 1223217746, 7765746464, 7719108109, 7719108109, 7719108109, 2080793071, 7883305092, 7893056461, 1623829653, 1162764164, 7477451471, 7455397029, 1162547383, 2045716901, 2476396145, 7359838881, 7359838881, 3300430239, 7838562185, 3456723723, 918013550295,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988490105
- Pageviews today : 660505
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
2392400864
+442392400864
automated rubbish call
Entrust Datacard
electrical appliances acorn domestic appliance services newton abbot
I think the whoever/whatever was calling was from the year . I politely declined to pick up the phone call
HSBC spam
Chinese spammer
hardware lewden electrical industries (London)
SCAM
Accident Claims CompanySpam
Called me a man who introduced himself as "Frank" (without surname) in. He immediately became abusive and sounded drunk.
Rang constantly regarding a car accident I haven't had, didn't know my name and when told the information was incorrect changed to a medical neglect claim. Very abusive
property developers birch homes (southern) ltd (London)
facilities services care services ltd
Other people said thus was nuisance
town planning consultants metropolitan transport research unit (London)
heating equipments tower flue components ltd tonbridge
interior designers and furnishers van harinxma (London)
garden centres and nurseries john colley & sons cannock
potteries diesel ltd stoke on trent manufacture of motor vehicles,trailers and semi trailers
dairies kingston farm ringwood hampshire
Extorsión
felbridge cricket club sports clubs east grinstead rh19 1ab
s & m tyres ltd. Garages repair and modification pulborough rh20 1ap
chemists and pharmacists hills pharmacy hook hampshire
Rang off when I answered
chauffeur driven cars location cars ltd (London)
the wooden window co ltd trowbridge f construction
SPAM
Fraud
ON THE 23RD NOVEMBER 2015 I RECEIVED A CALL FROM NUMBER 01455342639. I HAVE RECEIVED THIS NUMBER SEVERAL TIMES, BUT HAVE NEVER CALLED THIS NUMBER.
engineering services marcroft engineering ltd rochester
They won't leave me alone just because I was stupid enough to leave my number.... even after telling them I would be visiting them wearing a large bomb vest....
23 Nov 2021 - Just had a call from this number, but didn't answer as I was on another call. Good to know it was probably a suspicious call.Reply
Oakham
Tried to call me glad I didn t answer after reading this! They get your number if a payment on an agreement defaults (for what ever reason!)
They knew my name and address, but asked for my age and said that my answers would help release new products. When I asked who they were I was told UK Preference. I asked for him to stay on the phone whilst I looked up the company on the internet he immediately hung up
charles j robinson and co wolverhampton real estate activities
caterers regent catering rotherham
A complete scam as my AV is up to date. Just close the browser and get on with your life
charities and voluntary organisations social services department lytham st annes lancashire
n j m (guildford) ltd. Stationery guildford gu4 7wa
Electrical Engineers and Contractors Engineering Projects Development Ltd St Helens Merseyside
ambulance chaser
Claimed to be from Virgin but I called Virgin and they said this is not a number they have on file. Blocked the number. Not sure what they were after.
the bosuns locker south queensferry
Third call about a non-existent accident in which I was supposed to have been injured 2.5 years ago
theatres and concert halls apollo victoria theatre (London)
Say and they keep ringing back
take away dover court fish bar burton-on-trent
self catering inchree chalets & bunkhouse
London
microfilming services dentil eleven ltd goole
training and career matters ltd romford education
Fraud
kubota u k ltd thame
pubs, bars and inns l t p (inns) ltd stoke-on-trent
a m transformers ltd
old me i had a law suit against me, impersonating HMRC but was a completely recorded announcement. SCAM
technical and agricultural colleges london esthetique (education) ltd (London)
citigate plr holywood
SPAM when calling back number number not reconised
Maidenhead
greenwoods rugby k business services
This arse bandit just called.
Portishead
menswear savage ashton-under-lyne lancashire
Livestock and Others Wallum Farms Ltd. Southminster
reed computing personnel bristol
newsagents - retail d's newsagents (London)
If you answer or ring back call costs 5 pounds
business networking solutionsltd dundee computing and related activities
Was told I was a taxi driver who had an accident in the last 3 years don't even have a driving licence was quite rude when I didn't tell him what he wanted to here
daniel platt ltd
central heating m axon south wirral merseyside
shauna fay belfast belfast
Architects Heywood Developments Ltd. Canvey Island
Insurance Brokers Phillips Weir Blyth Northumberland
auto dealers mvm south wirral merseyside
drs lord lord findlay smith & sawczyn - nhs clinics Halifax
Bank/Lonas
unison membership
clubs and associations hythe and district social club southampton hampshire
taxis and private hire a 1 rushmoor radio taxis aldershot hampshire
communication management services ryton post and telecommunications
social services child & family disabilities - Swansea
carpetright
Someone from this number keeps ringing John Dale Ltd in Flint, but we get no answer from them!
calverley carpets
Similar numbers are already reported here with accident chasers - probably this one is the same case, same call centre? I don't answer unknown numbers and they left no message. Have missed calls from them on my mobile, was trying to dig some info on the internet before calling them back, but found nothing, no luck. People pls did someone answer this number, who is it?
nexus internet solutions ltd
Calling to check on Domain setup progress and try to upsell some items.
this number 74 has called me a few times this week did not answer checked on here its now blocked
car accident claim
SCAM
m a services ltd rochester construction
the miah tandoori take away tamworth b79 7pa
iron approach lewes retail trade, except of motor vehicles
admicra nottingham
accessories and parts peter buckles trading co ltd (London)
Telemarketing