2920501764 (02920501764)
Who called me from phone number 2920501764 Cardiff
Who called me from 2920501764
Phone number 2920501764 it's a landline number from Cardiff. This phone number has been searched 1 times. The first search was on 2026-02-20 09:55:27 and the last on 2026-02-20 10:56:27. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
2920501764 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+4429
Phone number 2920501764 - 0 opinions
Reviews for phone number 2920501764
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 2920501764
QR Codes for number +44 2920501764




Phone number 2920501764 (+442920501764)
Country: United Kingdom
Country code: +44 (0044)
City: Cardiff
Directional local: 29 (029)
Code: 4429 (004429)
This number was searched 1 times
First date of search: 2026-02-20 09:55:27
Date of last check of this number: 2026-02-20 10:56:27
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 671050292
A similar number: 292050729, 292050126, 292050514, 292050681, 293150176, 293150176, 296150176, 292350176(29 20 50 729,29 20 50 126,29 20 50 514,29 20 50 681,29 31 50 176,29 31 50 176,29 61 50 176,29 23 50 176)
Previous phone numbers: 2920501763 2920501762 2920501761 2920501760 2920501759 2920501758 2920501757 2920501756 2920501755 2920501754 2920501753 2920501752 2920501751 2920501750 2920501749 2920501748 2920501747 2920501746 2920501745 2920501744 2920501743 2920501742 2920501741 2920501740 2920501739 2920501738 2920501737 2920501736 2920501735 2920501734 2920501733 2920501732 2920501731 2920501730 2920501729 2920501728 2920501727 2920501726 2920501725 2920501724 2920501723 2920501722 2920501721 2920501720 2920501719 2920501718 2920501717 2920501716 2920501715 2920501714 2920501713 2920501712 2920501711 2920501710 2920501709 2920501708 2920501707 2920501706 2920501705 2920501704 2920501703 2920501702 2920501701 2920501700
Next phone numbers: 2920501765 2920501766 2920501767 2920501768 2920501769 2920501770 2920501771 2920501772 2920501773 2920501774 2920501775 2920501776 2920501777 2920501778 2920501779 2920501780 2920501781 2920501782 2920501783 2920501784 2920501785 2920501786 2920501787 2920501788 2920501789 2920501790 2920501791 2920501792 2920501792 2920501793 2920501794 2920501795 2920501796 2920501797 2920501798 2920501799 2920501800 2920501801 2920501802 2920501803 2920501804 2920501805 2920501806 2920501807 2920501808 2920501809 2920501810 2920501811 2920501812 2920501813 2920501814 2920501815 2920501816 2920501817 2920501818 2920501819 2920501820 2920501821 2920501822 2920501823 2920501824 2920501825 2920501826 2920501827 2920501828 2920501829 2920501830 2920501831 2920501833 2920501833 2920501834
(Previous phone numbers: 02920501763 02920501762 02920501761 02920501760 02920501759 02920501758 02920501757 02920501756 02920501755 02920501754 02920501753 02920501752 02920501751 02920501750 02920501749 02920501748 02920501747 02920501746 02920501745 02920501744 02920501743 02920501742 02920501741 02920501740 02920501739 02920501738 02920501737 02920501736 02920501735 02920501734 02920501733 02920501732 02920501731 02920501730 02920501729 02920501728 02920501727 02920501726 02920501725 02920501724 02920501723
Next phone numbers: 02920501765 02920501766 02920501767 02920501768 02920501769 02920501770 02920501771 02920501772 02920501773 02920501774 02920501775 02920501776 02920501777 02920501778 02920501779 02920501780 02920501781 02920501782 02920501783 02920501784 02920501785 02920501786 02920501787 02920501788 02920501789 02920501790 02920501791 02920501792 02920501792 02920501793 02920501794 02920501795 02920501796 02920501797 02920501798 02920501799 02920501800 02920501801 02920501802 02920501802 02920501803)
+44 02920501764 reviews
Add your opinion about +442920501764
UK 2920501764
mobile phone prices in india
Who called from number 2920501764
You can rate other simmilar phone numbers from Cardiff, searched in our database
| 2920536468 | 2920588343 | 2920518178 |
| 2920652281 | 2920908080 | 2920854907 |
Random searched phone numbers
| 658 838 2681 | 935 261 9846 | 413 665 9898 |
| 180 151 4726 | 825 463 8842 | 500 943 7196 |
Top rated phone numbers
2076710242 Fraud1295696016 Call reporting to be from Amazon and a 7999 renewall Press 1 to call the accounts department - SPAM SPAM SPAM - DO not repond drop the call
1756753887 robert holmes - architects Skipton
1706823688 pubs bars and inns the rose crown bury lancashire
1514480826 airline services reed operations liverpool merseyside
2920250650 Cardiff
1519220348 a g ventilation ltd bootle d manufacturing
2882841330 mcquaids hair salon china and glassware retail omagh county tyrone
1242214645 I have had two phone calls today from this company First one stating that I owe a parking charge notice that was 60 Now stating its 175 Said if I paid 20 today and if I give my bank details that they would not issue any further court action I explained that I was sat with my mental health support worker at the time and he said he would call back When they phoned back I stated I was unable to make a payment the Scottish guy became very passive aggressive and told me that he would be taking further action and
2030973301 Missed call
1224734607 martial arts instruction scottish shokatan centre
1260288690 SCAM
1706845202 metal waste and scrap dealers b howarth son oldham lancashire
1384898765 advanced finishing technologies ltd stourbridge
2158796587 Called I spoke then they cut me off I will ban these calls
684744025 OPLICHTERIJ
1213087773 mayvek engineering ltd precision engineers sutton coldfield b74 4aa
1617685713 keep calling slightly diff nos
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
1159420010 park hotel
1512206060 florists - retail natrel fleur liverpool merseyside
7985187628 London
8437243049 STOP CALLING ME YOU fking IDIOTS
8458381543 Dials at antisocial times so you will call them back on their premium rate number
1743367225 photographers meridian photography shrewsbury
1142737331 capita hartshead sheffield j financial intermediation
1314724111 business and trade meat livestock commission
1954582232 People did someone answer this number I had few missed calls from this one probably some call centre robocaller testing my number I dont answer unknown numbers and they left no message I was trying to dig some info on the internet dont want to call them back until I know who might be calling but no luck Some idea who is it
8710971071 one stop pub shop skelmersdale
8456430595 aero networks limited gateshead tyne and wear
Number popularity chart 2920501764
Your opinion about telephone number 2920501764 (292 050 1764)
Who called from 02920501764?: Who called from UK Cardiff ??? Who is calling from 02920501764?? On our site a very transparent way you will check the location of an unknown phone number as well as see the location on the map I check from what city was the connection I check the ranking of the given number his opinion comments and statistical data among others How many times a given Number unknown number was searched for how many views when was the first search date and when was the last search date of this phone number. Don't risk additional costs by calling or receiving a call from an unknown phone number. Always try to check unknown connections by phone numbers you have not seen or do not know yet. It is safe here to check the phone numbers in our database and on other websites. Mobile phone prices in india. Tell your friends about our site and let me know that they can check every unknown number in our number database for free at any time at any time. We invite you to check phone numbers and add opinions.
Possible number records of 02920501764 02920-501-764
+442920501764 |
00442920501764 |
2920 501 764 |
29 20 50 176 4 |
292 05 01 76 4 |
29-20-50-176 4 |
0044 2920-501-764 |
00 44 292 05 01 764 |
(+44)2920501764 |
29 20 50 176 4 |
(29) 2050 176 4 |
00 44 (29)2 05-01-76-4 |
+442920501764 In words... 292 050 1764
two thousand nine hundred twenty five hundred one seven hundred sixty four |
two nine two zero five zero one seven six |
Possible number records of 2920501764
Last rated phone numbers
7712378436, 7917208826, 2045790585, 1214681657, 7860099938, 7359027357, 7359, 1904736807, 1915800082, 1908103710, 1873440629, 7451287719, 7418370139, 1633603534, 1908103227, 7027000119, 2031544943, 3316301736, 2031293705, 1352756353, 7585715385, 1792722193, 7830581557, 2035144341, 1352757977, 1633603863, 7577531877, 2045870979, 1975354616, 7736701738, 7526919350, 2081356806, 1253835948, 7947801292, 7367300221, 2045870436, 7818015748, 1157911136, 1733964915, 7537159779, 7871484755, 7591956274, 7922253152, 8000211371, 2045870282, 1617288124, 1135349508, 7766880774, 7766880774, 7949282796,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988497263
- Pageviews today : 667663
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
2920501764
+442920501764
medicines and therapies sirius natural therapy & teaching centre hove
armstrong bell london k business services
pubs, bars and inns butchers arms liskeard
c-tech electronics ltd worthing manufacture of electrical machinery and apparatus nec
A English number, as I don't know anyone from there or who is on holidays over their guessing it's another annoying we want money call
tv, video and radio yelverton television services yelverton
Calling to check on Domain setup progress and try to upsell some items.
laboratories for applied biology ltd
hotels glyn-y-coed hotel - Criccieth
solicitors noel starke and co crawley
nhs clinics nuffield clinic plymouth
michael j page computers ltd colchester k business services
This is the second time I have been called from a Birmingham number. I had already blocked the number last time. It's the same company but I can't make the name out. I...
Road Haulage Gordons Transport Ltd Goole North Humberside
HSBC spam
DO NOT ANSWER OT!
florists - retail c suett & son (London)
This number called me twice today while I was at work, no information on the number anywhere. Area code was the code for my area so wondered who it could be. Called again while ...
salon services ltd falkirk other service activities
petrol stations warren service station (London)
Trying to sign u up for a consultation for online trading.
RTC call.... hung up.
rehab works
Honda Milton Keynes Dealer
barratt sales and marketing hitchin manufacture of food products and beverages
johnson web ltd peterborough cambs
china and glassware - retail thomas goode & co ltd (London)
don't want it
s & m tyres ltd. Garages repair and modification pulborough rh20 1ap
Insurance scam folks. Stay safe
datem lincoln other business activities
local government aberdeen city council
silent caller
chimney sweeps f r h boiler & chimney cleaners (London)
Equestrian - Education Pipers Farm Livery Yard Loughton
Scam
Janie just called letting me know i could make £ a month with no effort also. Janie should go and take some of her own advice and stop making silly calls!
surveyors and valuers laurence nesbitt (London)
called me 10 times today
Ppi nuisances
Tiling Contractors Ceramic Tiling Colchester
Seems to be used for some telemarketing call center - this range of numbers 16181490xx (common feature, they use more numbers of the same range) is mostly reported with some wide-scope telemarketing call centre, reported with PPI, insuarance marketing, loa
chauffeur driven cars location cars ltd (London)
refrigeration equipments peter drury blackpool lancashire
carpet and upholstery cleaners harvey's carpet cleaning gillingham
Fraud trying to steal money from people who have lost dogs. Pretending to have the dog but won't send pictures or anything until money is sent.
nurseries and creches puffins of exeter exeter
Scam call claiming HMRC have a tax fraud case against you
mightymast leisure ltd
doctors general practitioners o p shrivastava rotherham
missed call from this number, who is it?
cornish celtic knitwear st ives d manufacturing
This is Holmes Financial Services based in Liverpool. Scam message, there is no free plan to clear your debts at £ a month. Reported for misleading sales.
fashion shops barons court fashion (London)
Swindon
theme parks amazon sales - Rhyl
SCAM - states internet supplier has detected illegal activity and will disconnect in 24 hours unless speak to executive!! Automated
Fraud not my bank just a bunch or horrible thieves
Leicester
company calling themselves SCC financial claims company, pain in the arse. number blocked
gasson & green ltd. Electrical engineers and contractors burgess hill rh15 8eu
cheltape engineering ltd cheltenham
02082652342 Scam - pretending to be BT about to cut off internet
c q s ltd worcester other business activities
This no keeps ringing me constantly had enough pick up the phone and they just hang up. When I try to ring back the line is constantly engaged. Have no idea who this is can you ...
evolutionary thinking ltd. manchester lancashire
catherine wylie irvine ayrshire
BT about open reach phone line checking who your provider is and that you are happy with the way your service runs through the line
spice publishing services ltd london publishing and media
Survey usual
facilities services care services ltd
This number keep calling me.
spam finance company
butchers geoffs choice meats liverpool merseyside
Painter and Decorators Proforce Rayleigh
SCAM
They called me saying they have jobs in sales.
Google lifestyle claims. Charge you upfront to reclaim PPI which you can do yourself for free
religious organisations clc international sheffield
china and glassware retail mugshot newport isle of wight
Calling from a consumer lifestyle company who phoned earlier in the week, Indian accent, ignored my previous request to stop calling me
Blocked this number to many calls, so annoying.
rocking horse nursery nurseries and creches godalming gu7 1lg
bell office systems warminster wholesale trade and commission trade
They won't leave me alone just because I was stupid enough to leave my number.... even after telling them I would be visiting them wearing a large bomb vest....
calls but does not answer
Rang but no message left.
amrita singh slough berkshire
Was unable to answer because I was at work, but glad I looked up number first.
hung up when answered
taxis and private hire eddie's taxis - Pontypridd
Halkirk
retail kitchen ware hot rox pizza baking stone wigan lancashire
self catering hendre mawr farm caravan park - Bala
broadcasting services trojan television ltd (London)
nursing homes eastyne home for the elderly worthing
fashion shops famous names st helens merseyside
chemists and pharmacists roughwood chemists liverpool merseyside
finance pikeys
boat repair and builders longport broakerage stoke on trent