7720636233 (07720636233)
Who called me from phone number 7720636233
Who called me from 7720636233
Phone number 7720636233 it's a mobile number from the O2 network. This phone number has been searched 1 times. The first search was on 2026-02-20 09:52:25 and the last on 2026-02-20 10:53:25. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
7720636233 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+44
Phone number 7720636233 - 0 opinions
Reviews for phone number 7720636233
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 7720636233
QR Codes for number +44 7720636233




Phone number 7720636233 (+447720636233)
This number was searched 1 times
First date of search: 2026-02-20 09:52:25
Date of last check of this number: 2026-02-20 10:53:25
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 326360277
A similar number: 77206341, 772063812, 772063777, 772063948, 773863623, 773863623, 774163623, 779663623(77 20 63 41,77 20 63 812,77 20 63 777,77 20 63 948,77 38 63 623,77 38 63 623,77 41 63 623,77 96 63 623)
Previous phone numbers: 7720636232 7720636231 7720636230 7720636229 7720636228 7720636227 7720636226 7720636225 7720636224 7720636223 7720636222 7720636221 7720636220 7720636219 7720636218 7720636217 7720636216 7720636215 7720636214 7720636213 7720636212 7720636211 7720636210 7720636209 7720636208 7720636207 7720636206 7720636205 7720636204 7720636203 7720636202 7720636201 7720636200 7720636199 7720636198 7720636197 7720636196 7720636195 7720636194 7720636193 7720636192 7720636191 7720636190 7720636189 7720636188 7720636187 7720636186 7720636185 7720636184 7720636183 7720636182 7720636181 7720636180 7720636179 7720636178 7720636177 7720636176 7720636175 7720636174 7720636173 7720636172 7720636171 7720636170 7720636169
Next phone numbers: 7720636234 7720636235 7720636236 7720636237 7720636238 7720636239 7720636240 7720636241 7720636242 7720636243 7720636244 7720636245 7720636246 7720636247 7720636248 7720636249 7720636250 7720636251 7720636252 7720636253 7720636254 7720636255 7720636256 7720636257 7720636258 7720636259 7720636260 7720636261 7720636261 7720636262 7720636263 7720636264 7720636265 7720636266 7720636267 7720636268 7720636269 7720636270 7720636271 7720636272 7720636273 7720636274 7720636275 7720636276 7720636277 7720636278 7720636279 7720636280 7720636281 7720636282 7720636283 7720636284 7720636285 7720636286 7720636287 7720636288 7720636289 7720636290 7720636291 7720636292 7720636293 7720636294 7720636295 7720636296 7720636297 7720636298 7720636299 7720636300 7720636302 7720636302 7720636303
(Previous phone numbers: 07720636232 07720636231 07720636230 07720636229 07720636228 07720636227 07720636226 07720636225 07720636224 07720636223 07720636222 07720636221 07720636220 07720636219 07720636218 07720636217 07720636216 07720636215 07720636214 07720636213 07720636212 07720636211 07720636210 07720636209 07720636208 07720636207 07720636206 07720636205 07720636204 07720636203 07720636202 07720636201 07720636200 07720636199 07720636198 07720636197 07720636196 07720636195 07720636194 07720636193 07720636192
Next phone numbers: 07720636234 07720636235 07720636236 07720636237 07720636238 07720636239 07720636240 07720636241 07720636242 07720636243 07720636244 07720636245 07720636246 07720636247 07720636248 07720636249 07720636250 07720636251 07720636252 07720636253 07720636254 07720636255 07720636256 07720636257 07720636258 07720636259 07720636260 07720636261 07720636261 07720636262 07720636263 07720636264 07720636265 07720636266 07720636267 07720636268 07720636269 07720636270 07720636271 07720636271 07720636272)
+44 07720636233 reviews
Add your opinion about +447720636233
UK 7720636233
phone call finder
Who called from number 7720636233
You can rate other simmilar phone numbers searched in our database
| 7720650503 | 7720673970 | 7720658307 |
| 7720493100 | 7720485159 | 7720642503 |
Random searched phone numbers
| 512 175 0998 | 362 561 2728 | 586 208 1736 |
| 268 418 7422 | 690 294 9905 | 943 236 0471 |
Top rated phone numbers
2031350400 spam finance company1202022116 Calling to check on Domain setup progress and try to upsell some items
1766522478 ice cream - manufacturers cadwalader ice cream ltd - Criccieth
1158713925 Blocked this number to many calls so annoying
2081443802 Had two calls from Anshul re energy supply for village hall Thought wed check it out before saying anything to him or giving him the number of the person really responsible for gas and electricity Must have got our details from teh charities commissio
1224213373 training centres and products scottish training foundation
7809226866 CAMBRIDGE
1342834012 dennis c lawrence builders lingfield rh7 6jg
1293553470 virgin megastore record tape and cd crawley rh10 1ff
7770964786 SCAM phoned to tell me my NI number had been cancelled due to illegal activity If I didnt respond by the end of the day the police would be around to arrest me
2085903795 Painter and Decorators Malfield Decor Romford
2077354104 pet foods pets pantry London
2034671768 The administration of the website calledcouk invites you to post comments about this phone number
2054236589 I keep telling them I dont want to talk to them and to never to phone me again
7537158556 This person is a scammer
1851870639 isles business services isle of lewis computing and related activities
2036313036 SCAM SPAM
7423503795 Fraud
1212684533 RTC call hung up
2033070288 Bloody ripoff was told I would have money in my account guaranteed 48hr they charged me 47 quid it s been 2 weeks and still nothing i ring them everyday all they tell me is defiantly will ring me today DONT TRUST THEM
1516253777 c a sparkes wirral other business activities
2087494668 export and import agents merrell international health ltd London
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
1932584000 cedar ltd Computer systems and software cobham kt11 1hy
1698824311 botterills glasgow retail trade except of motor vehicles
8001831833 Keep calling no message left Data collecting
1708907962 proper parasites
1759318050 future images york other business activities
1738451000 Plumbers merchants thistle plumbing supplies ltd
2838333553 anfield transport road haulage craigavon county armagh
Number popularity chart 7720636233
Your opinion about telephone number 7720636233 (772 063 6233)
Who called from 07720636233?: Among the missed calls in saved reviews in our database by our users, you can usually meet all kinds companies and institutions such as offices, courier companies, transport companies, telemarketing, insurance companies, sales by telephone, consolidation loans, cash loans and payday loans as well as mobile telephony (Orange, T-mobile) calling us with a new offer. It is in these departments that many calls are often executable, but often after calling back on a given phone number, no one answers or We connect directly to the central where we do not know who called us. Phone call finder. In this situation, the best solution is to find an opinion on a given telephone number, to know who called us and whether we should call back or next time we answer the phone.
Possible number records of 07720636233 07720-636-233
+447720636233 |
00447720636233 |
7720 636 233 |
77 20 63 623 3 |
772 06 36 23 3 |
77-20-63-623 3 |
0044 7720-636-233 |
00 44 772 06 36 233 |
(+44)7720636233 |
77 20 63 623 3 |
(77) 2063 623 3 |
00 44 (77)2 06-36-23-3 |
+447720636233 In words... 772 063 6233
seven thousand seven hundred twenty six hundred thirty six two hundred thirty three |
seven billion seven hundred twenty million six hundred thirty six thousand two hundred thirty three |
Possible number records of 7720636233
Last rated phone numbers
7712378436, 7917208826, 2045790585, 1214681657, 7860099938, 7359027357, 7359, 1904736807, 1915800082, 1908103710, 1873440629, 7451287719, 7418370139, 1633603534, 1908103227, 7027000119, 2031544943, 3316301736, 2031293705, 1352756353, 7585715385, 1792722193, 7830581557, 2035144341, 1352757977, 1633603863, 7577531877, 2045870979, 1975354616, 7736701738, 7526919350, 2081356806, 1253835948, 7947801292, 7367300221, 2045870436, 7818015748, 1157911136, 1733964915, 7537159779, 7871484755, 7591956274, 7922253152, 8000211371, 2045870282, 1617288124, 1135349508, 7766880774, 7766880774, 7949282796,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988493660
- Pageviews today : 664060
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
7720636233
+447720636233
virgin megastore record, tape and cd crawley rh10 1ff
Supermarkets Costcutter Goole North Humberside
c-tech electronics ltd worthing manufacture of electrical machinery and apparatus nec
SCAM I have checked this number out and was brave enough to find out and ring it and somebody other end had told me that that is a scam number it is confirmed it is a scam
pubs bars and inns the coach & horses (London)
SPAM
portable buildings portakabin ltd smethwick
Scam loan company
chauffeur driven cars brooklands chauffeur services southampton hampshire
aluminium stockholders pro-lam ltd haywards heath
Unsolicited call from an 'advisory' service which was actually a company wanting to reclaim mis sold PPI. Fourth call from this number told them to delete me from data base and he still tried to sell me their service. Persistent nuisance callers.
pubs bars and inns the fisherman's inn
stuart marshall daventry northamptonshire
barristers nicholas leviseur (London)
antique dealers c weissler (London)
maintenance and repairs advance maintenance (London)
air cargo engineering manchester k business services
lackie and co edinburgh k business services
Fraud
unisex hairdressers salon mand-a-lyn newcastle
skin styles tattoo and body piercing studio thetford other service activities not elsewhere classified
asking me to confirm accident ..reported to them by the rt department when asked repeatedly who rt department was ..they hung up
mcdougall surveyors isle of bute k business services
beauty saloons the house of beauty barnsley
a recorded message woman's voice, american accent- was played saying i had been charged £399...for something from Amazon. not true- put the phone down.
Road Haulage E Harris Transport Rainham
This bunch of "rude words" (keeping it clean for the website) are a complete and utter pain in the bum! They have rung 18 times today alone asking for "Susan"! There is no-one called "Susan" and the only "Susan" I know is my cousin who has lived abroad since she was 2 (certainly hasn t lived in our house!). When I say "No-one called Susan lives here" they say "Well, you ll do". Erm, no I won t "DO"! The last idiot had a taste of his own medicine! When he said "Can I speak to Susan (surname which is mi
ims
fox and sons bournemouth real estate agencies
medicines and therapies sirius natural therapy & teaching centre hove
paper and cardboard anthony dunne decorators bromley
Caller claims to have money from a PPI on your credit card
take away gala delicatessen (London)
MARGATE
survey answer some questions
engineers francis kirk (socket screws) ltd. Manchester manchester
Another automated call saying bank security and 2 transactions have occured,always same amounts and by same people.Block the number and comes through again on different number.
SCAM This number appeared on my Bill £6.45 for 7 seconds
Bracknell
strysin buckingham buckinghamshire
B&Q Longwell Green
the bosuns locker south queensferry
no speaking at all
Scam as above claiming to be Virgin media
ambulance chaser
ryan design & publishing graphic designers craigavon county armagh
Barnsley
norry's automotive service welders morden sm4 6se
This number called me twice today while I was at work, no information on the number anywhere. Area code was the code for my area so wondered who it could be. Called again while ...
the anchor pubs, bars and inns woking gu23 6qw
garden centres and nurseries john colley & sons cannock
potteries diesel ltd stoke on trent manufacture of motor vehicles,trailers and semi trailers
textile floorcoverings f mount & son (contracts) ltd barnsley
Said he was from O2. I cut the call short so don't know any more.
china and glassware retail mugshot newport isle of wight
alabaster & wilson ltd jewellery design birmingham b1 3ld
This arse bandit just called.
Colchester
Same 'you have won £650k' scam.
self catering inchree chalets & bunkhouse
sheet metal work t c s fabrications oldham lancashire
local government ruscoe road sheltered housing (London)
Inverness
charities and voluntary organisations re-use - Builth Wells
haselmere homes bedford real estate activities
clubs and associations nova management ltd (London)
DO NOT ANSWER OT!
chimney sweeps f r h boiler & chimney cleaners (London)
chiropodists - podiatrists a whiteing chesterfield
first steps nursery bath m education
Central heating central heating & electrical co
Painter and Decorators Malfield Decor Romford
consulting engineers jacobs u k ltd
Sunday 13.48 got a call asking ot speak to somone that mved away from this house oever a year ago. When I called back to see where they were calling from the answer machineg said GNSK doing a survey.
building surveyors tom macdonald
Not know but as I have blocked their other numbers presume the scum have gone on to the next one on their predial
doctors general practitioners the cowes health centre cowes isle of wight
stalker
chinese - general oakwood palace ltd (London)
picturetel uk ltd slough 7020
rehab works
solicitor
heros derby h hotels and restaurants
laughing dog products pet foods rugby cv23 9ln
mixed crops william nesbit
biffa waste services ltd - waste disposal services Brighouse
charities and voluntary organisations social services department lytham st annes lancashire
menswear hugo boss
Auto dealers r d motors ltd
funeral services nichols stafford
The administration of the website called.co.uk invites you to post comments about this phone number.
m and d greenwood keighley n health and social work
prestons london london
Architectural Paul Newbould Clacton-on-Sea
The administration of the website called.co.uk invites you to post comments about this phone number.
swindon fashion shops the jaeger co ltd
mot testing m o t wavel testing centre rossendale lancashire
options night clubs leamington spa cv31 3an
Called me late evening. The lady mumbled her name and the company she was calling from, quoted my full name and an address I lives in two years ago. When I said I didn't live at this address she said 'oh, sorry' and hung up.
fashion shops zaverchand (London)