2086609705 (02086609705)
Who called me from phone number 2086609705 London
Who called me from 2086609705
Phone number 2086609705 it's a landline number from London. This phone number has been searched 123 times. The first search was on 2023-04-17 20:40:23 and the last on 2026-02-20 10:50:33. We have 1 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 10 ( excellent opinion ).
2086609705 Trust level
100 %
Ranking:
Searched:
123
First search:
2023-04-17
Directional:
+4420
Phone number 2086609705 - 1 opinions
marievele's marquees marquees, tents and floor purley cr8 2hj
Review for phone number 2086609705 by Chenel
Date added: 2018-07-09 23:12:37
Delete review of phone number 2086609705
QR Codes for number +44 2086609705




Phone number 2086609705 (+442086609705)
Country: United Kingdom
Country code: +44 (0044)
City: London
Directional local: 20 (020)
Code: 4420 (004420)
This number was searched 123 times
First date of search: 2023-04-17 20:40:23
Date of last check of this number: 2026-02-20 10:50:33
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 079066802
A similar number: 208660800, 208660917, 208660175, 20866015, 207160970, 207160970, 208260970, 201160970(20 86 60 800,20 86 60 917,20 86 60 175,20 86 60 15,20 71 60 970,20 71 60 970,20 82 60 970,20 11 60 970)
Previous phone numbers: 2086609704 2086609703 2086609702 2086609701 2086609700 2086609699 2086609698 2086609697 2086609696 2086609695 2086609694 2086609693 2086609692 2086609691 2086609690 2086609689 2086609688 2086609687 2086609686 2086609685 2086609684 2086609683 2086609682 2086609681 2086609680 2086609679 2086609678 2086609677 2086609676 2086609675 2086609674 2086609673 2086609672 2086609671 2086609670 2086609669 2086609668 2086609667 2086609666 2086609665 2086609664 2086609663 2086609662 2086609661 2086609660 2086609659 2086609658 2086609657 2086609656 2086609655 2086609654 2086609653 2086609652 2086609651 2086609650 2086609649 2086609648 2086609647 2086609646 2086609645 2086609644 2086609643 2086609642 2086609641
Next phone numbers: 2086609706 2086609707 2086609708 2086609709 2086609710 2086609711 2086609712 2086609713 2086609714 2086609715 2086609716 2086609717 2086609718 2086609719 2086609720 2086609721 2086609722 2086609723 2086609724 2086609725 2086609726 2086609727 2086609728 2086609729 2086609730 2086609731 2086609732 2086609733 2086609733 2086609734 2086609735 2086609736 2086609737 2086609738 2086609739 2086609740 2086609741 2086609742 2086609743 2086609744 2086609745 2086609746 2086609747 2086609748 2086609749 2086609750 2086609751 2086609752 2086609753 2086609754 2086609755 2086609756 2086609757 2086609758 2086609759 2086609760 2086609761 2086609762 2086609763 2086609764 2086609765 2086609766 2086609767 2086609768 2086609769 2086609770 2086609771 2086609772 2086609774 2086609774 2086609775
(Previous phone numbers: 02086609704 02086609703 02086609702 02086609701 02086609700 02086609699 02086609698 02086609697 02086609696 02086609695 02086609694 02086609693 02086609692 02086609691 02086609690 02086609689 02086609688 02086609687 02086609686 02086609685 02086609684 02086609683 02086609682 02086609681 02086609680 02086609679 02086609678 02086609677 02086609676 02086609675 02086609674 02086609673 02086609672 02086609671 02086609670 02086609669 02086609668 02086609667 02086609666 02086609665 02086609664
Next phone numbers: 02086609706 02086609707 02086609708 02086609709 02086609710 02086609711 02086609712 02086609713 02086609714 02086609715 02086609716 02086609717 02086609718 02086609719 02086609720 02086609721 02086609722 02086609723 02086609724 02086609725 02086609726 02086609727 02086609728 02086609729 02086609730 02086609731 02086609732 02086609733 02086609733 02086609734 02086609735 02086609736 02086609737 02086609738 02086609739 02086609740 02086609741 02086609742 02086609743 02086609743 02086609744)
+44 02086609705 reviews
Add your opinion about +442086609705
UK 2086609705
free reverse number lookup cell
Who called from number 2086609705
You can rate other simmilar phone numbers from London, searched in our database
| 2086620330 | 2086697625 | 2086667648 |
| 2086343194 | 2086848962 | 2086958184 |
Random searched phone numbers
| 419 511 1234 | 275 934 3894 | 554 609 7707 |
| 996 463 9919 | 675 390 3851 | 978 343 8871 |
Top rated phone numbers
7670229557 a recorded message womans voice american accent- was played saying i had been charged 399for something from Amazon not true- put the phone down7931374992 Telemarketing - foot care scam
1698259888 heating contractors contract servicing ltd
2392241228 furniture general c f g b ltd waterlooville hampshire
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
2089640238 framing services graham harrison framing London
7973112586 knight hamilton international east croydon surrey
1392690878 liberty vet recruitment
2825871339 trend cards greeting cards ballymena county antrim
1925453058 Fraud Say theyre Virgin
2086724465 clothing - general blue skin London
1423241382 ppi garbage
2085080947 Garages - Repair and Modification Smart Lane Motor Repairs Accident Repairs Centre Loughton
1892618555 employment agencies and consultants sentinel i t ltd tunbridge wells
1494530573 The administration of the website calledcouk invites you to post comments about this phone number
1443491106 taxis and private hire eddies taxis - Pontypridd
2084370956 SCAM
1132069999 Diabetic centre at St J L
1721720832 Auto dealers r d motors ltd
1245465249 Gunsmith Leech Son Chelmsford
1782316421 household removals and storage william john wass stoke on trent
2030110060 Called today 21082017 at 825PM Silent but I could tell someone was on the other end of the phone I hung up
1269604942 Got a call answered it was about life insurance I dont own When asked what company they were calling by from he mentioned Aviva but hung up when I said I dont own a life insurance Call supposedly from Ammandford Wales Got a automated call earlier
8000698683 To close the message down without having to resart your computer Press CTRL-ALT-DEL choose the Task Manager option and then select the programme you want to close down ie Firefox Chrome Explorer etc
1690770219 agricultural advice bedwyr jones - Betws Y Coed
1709276586 The company is harrington advisory looks like theyre using a new call centre to bombard people about ppi
5713429802 BT Internet scam - pretending to cut off your Internet service and trying to get your IP address
1206385564 michael j page computers ltd colchester k business services
1273772030 jewellers gold arts brighton
1142255441 One of the sheff hallam uni contact numbers
Number popularity chart 2086609705
Your opinion about telephone number 2086609705 (208 660 9705)
Who called from 02086609705?: Who called from UK London ??? Who is calling from 02086609705?? On our site a very transparent way you will check the location of an unknown phone number as well as see the location on the map I check from what city was the connection I check the ranking of the given number his opinion comments and statistical data among others How many times a given Number unknown number was searched for how many views when was the first search date and when was the last search date of this phone number. Don't risk additional costs by calling or receiving a call from an unknown phone number. Always try to check unknown connections by phone numbers you have not seen or do not know yet. It is safe here to check the phone numbers in our database and on other websites. Free reverse number lookup cell. Tell your friends about our site and let me know that they can check every unknown number in our number database for free at any time at any time. We invite you to check phone numbers and add opinions.
Possible number records of 02086609705 02086-609-705
+442086609705 |
00442086609705 |
2086 609 705 |
20 86 60 970 5 |
208 66 09 70 5 |
20-86-60-970 5 |
0044 2086-609-705 |
00 44 208 66 09 705 |
(+44)2086609705 |
20 86 60 970 5 |
(20) 8660 970 5 |
00 44 (20)8 66-09-70-5 |
+442086609705 In words... 208 660 9705
two thousand eighty six six hundred nine seven hundred five |
two billion eighty six million six hundred nine thousand seven hundred five |
Possible number records of 2086609705
Last rated phone numbers
7745268386, 7536211388, 7742665280, 7512602075, 7728320673, 7545437254, 7466888519, 7728320673, 1243553951, 2037691834, 7709595718, 2922722090, 7964986532, 7359860140, 1644216392, 1803605359, 2045792453, 919229043193, 2045385434, 7704045454, 7921645711, 1913891632, 1619647939, 3303413407, 7812468297, 1494675111, 1902504285, 3303413046, 7391188080, 7565827573, 794326956, 2045381051, 1505287992, 2034249677, 7822000181, 7980876918, 7496033634, 1156461231, 7731317244, 1622419732, 7388, 3308182770, 1158775185, 7340675559, 3303413046, 3450130151, 2034107527, 1313812776, 1357333036, 7467321303,Who's called me uk
Who visited this number
| Nr | Country | Area | Provider | Ip |
|---|---|---|---|---|
| 1 | China | Shanghai | Aliyun Computing Co., LTD | 47.100.173.xx |
| 2 | Singapore | Singapore | AWS EC2 (ap-southeast-1) | 47.128.26.xx |
| 3 | United States | Virginia Beach | Webshare Software | 104.227.13.xx |
| 4 | United Kingdom | London | Oracle Cloud Infrastructure (uk-london-1) | 152.67.128.xx |
| 5 | United Kingdom | Birmingham | 109.146.16.xx | |
| 6 | Germany | Falkenstein | Hetzner | 176.9.117.xx |
| 7 | United States | Washington | SEMrush CY LTD | 185.191.171.xx |
| 8 | Germany | Falkenstein | Dataforseo OU | 136.243.228.xx |
| 9 | France | Paris | OVH | 54.36.148.xx |
Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988490459
- Pageviews today : 660859
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
2086609705
+442086609705
Nuisance call. Where do these people get my number from! Even knew my name!!!
john warren bookmakers kingston upon thames kt1 2hr
car accident parasites
local authority schools the john of rolleston primary school burton-on-trent
Automated your internet will be cut off in 24/48 hours scam! Idiots!
I believe that this is the same scamming ambulance chasing company whose other numbers include the following 0207946 and various last four digits 1369 / 0364 /0996 1821 Have blocked them all and think they keep ringing on different numbers cos their victims keep blocking them
Financial Advisers Brents of Brentwood Ltd. Brentwood
Said from Barclays asking for our MD. Gave this number with option 1 and requested a return call from him.... urgently !
This company phone to ask about my car accident 2 years ago. I keep telling them that I have been compensated and not to call me back. They call everyday!!!!!!!!
The administration of the website called.co.uk invites you to post comments about this phone number.
Rude @rs34013. Some sort of financial stuff, threatened me with a fine for wasting the company's time. In breech of GDPR.
Scam call about domain names and services
roughfort inn pubs, bars and inns newtownabbey county antrim
lda living and learning cambridge g wholesale and retail
SCAM / SPAM
Nuisance call
m b label services ltd thetford d manufacturing
a r information management consultants l computer consultants richmond tw9 2hd
BT FAKE Computer Hackers. They call you about your router then seek you hand over control remotely of your PC and steal all your files and information.
calverley carpets
estate agents northside agencies (London)
bradford van hire - van and truck hire Bradford
Called Sainsbury’s Bank they could not confirm this number. Spoke to fraud who also could not confirm. They said it might be but couldn’t be sure
d h signs leeds
take away newham grill (London)
evolutionary thinking ltd. manchester lancashire
Was unable to answer because I was at work, but glad I looked up number first.
ALDERMASTON WHARF
warners property management estate agents birmingham b48 7bt
computer maintenance (u k) ltd. Maintenance and repairs tech thames ditton kt7 0bh
kathleen r cheek - newsagents - retail Wetherby
Aromatherapy h doyle
Snooker billiards and pool brackla snooker centre - Bridgend
air cargo engineering manchester k business services
business consultants practices made perfect ltd (London)
I didnt received a call from this precise number but one close
shooting ground liskeard recreational, cultural and sporting activities
v whitehouse unisex hairdressers rowley regis b65 0ea
r mcdowell haulage and distribution ltd keighley land transport transport via pipelines
Missed call
Call A Cab NI
delivery services quick bite warrington cheshire
petrol filling stations tee shirts-r-us - Tenby
SCAM
appointment at West Suffolk hospital
They knew my name and address, but asked for my age and said that my answers would help release new products. When I asked who they were I was told UK Preference. I asked for him to stay on the phone whilst I looked up the company on the internet he immediately hung up
London
acuminous ipswich
air condition and refrigeration unit air conditioning systems ltd orpington
plumbing and heating james a girgan
The administration of the website called.co.uk invites you to post comments about this phone number.
mid ulster joinery coleraine co. londonderry
441332653712 from Derby 5 calls Avoid at all costs No idea who this caller is
Es un pedofilo de Santa María del Berrocal en Ávila Llamado DIEGO TOMAS MANSO CASELLES, con muchísimos antecedentes, por violencia de género hacia su ex pareja, y contra su madre , en 2008 se le incautaron 2 ordenadores portátiles con más de 2000 vídeos abusando de menores, detenido varias veces por urto,por tráfico de drogas, por intento de homicidio al intentar atropellar a un pastor de la localidad, por estafas continuas,robos de vehículos, y amenazas y allanamiento de morada y quebrantamiento de orden d
This number calls constantly day and night Initialy no one speaks so hang up
funeral plans asking you if you need one and also for wills service.. I was like no I don t feel like needing one now, and they answered are you sure? I was like... yea..
armstrong bell london k business services
Seems to be used for some telemarketing call center - this range of numbers 1916712xxx (common feature, they use more numbers of the same range) is mostly reported with PPI / insurance marketing. Just block it if not interested (I use the app from these pages, no problems) Folks did they call you with the same or something new?
middlesex itec ltd
west garage ltd cambridge g wholesale and retail
Livestock and others h j price - Swansea
insurance brokers r f hobson & co (insurance brokers) ltd lichfield
commercial vehicle dealers barnes of shoreham shoreham-by-sea
another compensation offer for my imaginary accident. boring boring boring
SCAM / SPAM
bulb growers m g reid
Debt management
spiers electronics verwood
willis corroon midlands and wales ltd cardiff j financial intermediation
moor allerton hall primary school - local authority schools Leeds
Called from this number by someone who sounded very Indian claiming to be from "internet provider TalkTalk" (I m not with them). It turned out to be the www.teamviewer.com / www.support.me scam where they claim "something is wrong with your computer" (they never tell you what). They then ask if there are lights flashing on your router - they should, of course, but they pretend that indicates a fault. I led them quite a dance for an hour and a half before getting fed up with struggling to understand their
doctors general practitioners corke, r t burnley lancashire
SCAM
don't talk when you answer
Scammer asking about my father who died 20 years ago
tarrock building services ltd southampton
The caller knew my name but as soon as she told me her name was Tatiana and mentioned Tax Credit I hung up and blocked the number straight away.
botterills glasgow retail trade, except of motor vehicles
systems & services computer systems and software croydon cr0 3ex
felbridge cricket club sports clubs east grinstead rh19 1ab
secondhand shops general dealer
greengrocers forber & sons wallasey merseyside
shauna fay belfast belfast
great taxi service. friendly helpful drivers
graham mickel and co crieff k business services
joinery acacia joinery ltd - Bridgend
National Hearing Helpline or National Hearing Centre - doesn't matter what name, the context is the same - pure telemarketing. They just try, same story : "Have you ever worked in a noisy environment...?" In fact insurance business, and in fact telemarketing, unsolicited call in my case. Probably can be helpful, but does someone have a possitive experience with them...?
insurance agents and companies hill house hammond ltd ashford
gambling or something. blocked
sears management ltd orpington other business activities
Fake HMRC call
The administration of the website called.co.uk invites you to post comments about this phone number.
car valet complete car clean
ask italian maidstone
Scam call saying they are from Amazon. American accent pre recorded message about your order.
h c c m systems ltd leamington spa computing and related activities
plumbing and heating steven g lee dronfield
camack ltd york wholesale trade and commission trade
electrical engineers and contractors ian bruce
cafes and tea rooms le petit pain (scotland) ltd