7980123902 (07980123902)
Who called me from phone number 7980123902
Who called me from 7980123902
Phone number 7980123902 it's a mobile number from the EE network. This phone number has been searched 1 times. The first search was on 2026-02-20 09:49:14 and the last on 2026-02-20 10:50:14. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
7980123902 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+44
Phone number 7980123902 - 0 opinions
Reviews for phone number 7980123902
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 7980123902
QR Codes for number +44 7980123902




Phone number 7980123902 (+447980123902)
This number was searched 1 times
First date of search: 2026-02-20 09:49:14
Date of last check of this number: 2026-02-20 10:50:14
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 093210897
A similar number: 798012895, 798012151, 798012333, 798012309, 792212390, 792212390, 793512390, 791612390(79 80 12 895,79 80 12 151,79 80 12 333,79 80 12 309,79 22 12 390,79 22 12 390,79 35 12 390,79 16 12 390)
Previous phone numbers: 7980123901 7980123900 7980123899 7980123898 7980123897 7980123896 7980123895 7980123894 7980123893 7980123892 7980123891 7980123890 7980123889 7980123888 7980123887 7980123886 7980123885 7980123884 7980123883 7980123882 7980123881 7980123880 7980123879 7980123878 7980123877 7980123876 7980123875 7980123874 7980123873 7980123872 7980123871 7980123870 7980123869 7980123868 7980123867 7980123866 7980123865 7980123864 7980123863 7980123862 7980123861 7980123860 7980123859 7980123858 7980123857 7980123856 7980123855 7980123854 7980123853 7980123852 7980123851 7980123850 7980123849 7980123848 7980123847 7980123846 7980123845 7980123844 7980123843 7980123842 7980123841 7980123840 7980123839 7980123838
Next phone numbers: 7980123903 7980123904 7980123905 7980123906 7980123907 7980123908 7980123909 7980123910 7980123911 7980123912 7980123913 7980123914 7980123915 7980123916 7980123917 7980123918 7980123919 7980123920 7980123921 7980123922 7980123923 7980123924 7980123925 7980123926 7980123927 7980123928 7980123929 7980123930 7980123930 7980123931 7980123932 7980123933 7980123934 7980123935 7980123936 7980123937 7980123938 7980123939 7980123940 7980123941 7980123942 7980123943 7980123944 7980123945 7980123946 7980123947 7980123948 7980123949 7980123950 7980123951 7980123952 7980123953 7980123954 7980123955 7980123956 7980123957 7980123958 7980123959 7980123960 7980123961 7980123962 7980123963 7980123964 7980123965 7980123966 7980123967 7980123968 7980123969 7980123971 7980123971 7980123972
(Previous phone numbers: 07980123901 07980123900 07980123899 07980123898 07980123897 07980123896 07980123895 07980123894 07980123893 07980123892 07980123891 07980123890 07980123889 07980123888 07980123887 07980123886 07980123885 07980123884 07980123883 07980123882 07980123881 07980123880 07980123879 07980123878 07980123877 07980123876 07980123875 07980123874 07980123873 07980123872 07980123871 07980123870 07980123869 07980123868 07980123867 07980123866 07980123865 07980123864 07980123863 07980123862 07980123861
Next phone numbers: 07980123903 07980123904 07980123905 07980123906 07980123907 07980123908 07980123909 07980123910 07980123911 07980123912 07980123913 07980123914 07980123915 07980123916 07980123917 07980123918 07980123919 07980123920 07980123921 07980123922 07980123923 07980123924 07980123925 07980123926 07980123927 07980123928 07980123929 07980123930 07980123930 07980123931 07980123932 07980123933 07980123934 07980123935 07980123936 07980123937 07980123938 07980123939 07980123940 07980123940 07980123941)
+44 07980123902 reviews
Add your opinion about +447980123902
UK 7980123902
phone book lookup
Who called from number 7980123902
You can rate other simmilar phone numbers searched in our database
| 7980196716 | 7980114596 | 7980185865 |
| 7980685145 | 7980756080 | 7980920763 |
Random searched phone numbers
| 975 620 8990 | 703 843 0875 | 971 281 5295 |
| 955 367 4670 | 455 425 9058 | 559 971 5677 |
Top rated phone numbers
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc1803227511 Riverford organics Veg delivery
1670825555 chisholm bookmakers bedlington o other services
963976862 Me acisa
1291424165 builders ronald thomas powell - Caldicot
1301702699 guttering services alpine gutters
2381872379 Pension scamPolice and Hampshire trading standards are dealing with this matterDo not release any personal information to the unidentified caller
7418372462 SCAM Pretending to be the HMRC
2037456462 When I called this number back it rang and then when the minutes started clocking like the phone had been answered the ringing sound continued Therefore I envisage it to be
1264849265 Got six calls from this unknown number today Anyone else receive same
1213680205 Missed call on Company Mobile I work for an Insurance Company Number now blocked
1225809905 Survey usual
1455342639 ON THE 23RD NOVEMBER 2015 I RECEIVED A CALL FROM NUMBER 01455342639 I HAVE RECEIVED THIS NUMBER SEVERAL TIMES BUT HAVE NEVER CALLED THIS NUMBER
2085922764 Cash and Carry Cromwell Card Co Ltd Dagenham
1242214645 I have had two phone calls today from this company First one stating that I owe a parking charge notice that was 60 Now stating its 175 Said if I paid 20 today and if I give my bank details that they would not issue any further court action I explained that I was sat with my mental health support worker at the time and he said he would call back When they phoned back I stated I was unable to make a payment the Scottish guy became very passive aggressive and told me that he would be taking further action and
1213187136 hung up when answered
7452082009 Since having a minor accident 8 months ago Ive now had calls from over 30 different accident claims company Absolutely sick of them Theyve got my home number work number and mobile number Relentless
7535059108 Solihull
1516478827 commercial cleaning services odec cleaning services birkenhead merseyside
1343870007 future plans
1332268934 offering solar power
1709276586 The company is harrington advisory looks like theyre using a new call centre to bombard people about ppi
1616814819 breakers and dismantlers failsworth auto spares manchester manchester
1204300171 television and radio aerials riley handling services ltd Bolton lancashire
1224522205 local government aberdeen city council
1293512123 e a b engineering services ltd electrical engineers and contractors crawley rh10 1ny
1670404157 Automated call telling me my internet connection will terminate in 24 hours Press 1 to resolve the problem
1472353373 olympus welding and industrial supplies grimsby d manufacturing
1273471438 iron approach lewes retail trade except of motor vehicles
1472313400 private clinics north lincolnshire goole hospital nhs grimsby
Number popularity chart 7980123902
Your opinion about telephone number 7980123902 (798 012 3902)
Who called from 07980123902?: Among the missed calls in saved reviews in our database by our users, you can usually meet all kinds companies and institutions such as offices, courier companies, transport companies, telemarketing, insurance companies, sales by telephone, consolidation loans, cash loans and payday loans as well as mobile telephony (Orange, T-mobile) calling us with a new offer. It is in these departments that many calls are often executable, but often after calling back on a given phone number, no one answers or We connect directly to the central where we do not know who called us. Phone book lookup. In this situation, the best solution is to find an opinion on a given telephone number, to know who called us and whether we should call back or next time we answer the phone.
Possible number records of 07980123902 07980-123-902
+447980123902 |
00447980123902 |
7980 123 902 |
79 80 12 390 2 |
798 01 23 90 2 |
79-80-12-390 2 |
0044 7980-123-902 |
00 44 798 01 23 902 |
(+44)7980123902 |
79 80 12 390 2 |
(79) 8012 390 2 |
00 44 (79)8 01-23-90-2 |
+447980123902 In words... 798 012 3902
seven thousand nine hundred eighty one hundred twenty three nine hundred two |
seven nine eight zero one two three nine zero |
Possible number records of 7980123902
Last rated phone numbers
1212850415, 7471790045, 1704791755, 2035236404, 2045870360, 7476254252, 1493759152, 1636705623, 2085744053, 918422052901, 7476254258, 7899240499, 2045711357, 2045256899, 1514534244, 1644216568, 7754920968, 44775107795, 120461121, 1442392324, 7741293282, 2031293300, 7908670414, 7401932396, 1189422010, 2080560783, 2045711342, 7803471903, 1260591147, 1296711109, 1615452042, 1234632191, 2045796687, 7949188795, 8008021456, 7340287161, 7926771721, 1617186104, 1235627615, 8458520770, 1206805914, 132437153, 7477189744, 1257470647, 1257470647, 7700169047, 7500124751, 7359322717, 3156325794, 1330567147,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988490103
- Pageviews today : 660503
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
7980123902
+447980123902
pyronix ltd rotherham d manufacturing
car upholsterers retail posh wash professional car valeting ringwood hampshire
Newton Abbot
dairies messrs tyson & woodend millom cumbria
carpets rugs and matting rutherglen market carpets
food service engineers ltd otley
rubbish don't answer
estate agents hall's estate agents ltd brighton
Dunfermline
Exhausts and shock absorbers kwik-fit
non rispondo più a nessun call center
VERY BAD ENGLISH OMG!
camtex ltd cleckheaton manufacture of man-made fibres
control panels systems a campbell electrical services
ANTRIM
Pubs Bars and Inns Hare and Hounds Inn Hexham Northumberland
rocking horse nursery nurseries and creches godalming gu7 1lg
lakeland cottage holidays
SPAM
rothery m.j mcsp srp private clinics midhurst gu29 9dr
middlesex itec ltd
steel stockholders mealham metal products ashford
Electrical Engineers and Contractors Engineering Projects Development Ltd St Helens Merseyside
Said from Barclays asking for our MD. Gave this number with option 1 and requested a return call from him.... urgently !
As per the other comments, Indian accent and referred to by name. Told me they were calling from a Financial Advice Bureau. When I advised that I am in fact a Financial Adviser myself he started to quiz me on different terms and called me a fraud. Please d
make money online
vanquis bank
maintenance and repairs paul denton portsmouth hampshire
pubs bars and inns dublin packet inn - Holyhead
charities and voluntary organisations social services department lytham st annes lancashire
waddington & ledger ltd - printers Elland
Scam
civil engineers kamscot construction ltd
banks barclays bank plc fareham hampshire
prizes claims ect
Call regarding windows. I requested they remove my details from the system and they continue to ask for my dad. This is how i know it's a sales call
counselling and advice ashford counselling service ashford
Call showed as INTERNATIONAL despite the London code. Hung up on answer.
confectioners m ray ltd. Prescot merseyside
insurance brokers inter alpha financial services ltd southampton hampshire
warners property management estate agents birmingham b48 7bt
SPAM Message was “Hello You” no business I have contact with uses this intro, so blocked as it is not in my WhatsApp contact list
ostriches ltd. Animal by products bagshot gu19 5qz
japanese translating norwich k business services
horticultural consultants application techniques ltd henfield
Basildon
jacksons cars cardiff g wholesale and retail
1234567891
The administration of the website called.co.uk invites you to post comments about this phone number.
Penfold Saddlery
brenda gills medicines and therapies haywards heath rh16 3ts
cricketers arms the - pubs bars and inns Huddersfield
very polite and helpful, never been happier with the savings this company (LGH) has made me highly recommend.
London
unison membership
Telemarketing by stealth - was I aware of Such and such product nNot following TPS
bulb growers sir philip grant-suttie
no responce
Pontefract
the last chance saloon london o other services
pubs bars and inns jay tees
They introduced themselves as Red Hot legal - sounded like some sort of call centre. Not a personal number anyway
Electrical Engineers and Contractors P & R Coleman Ltd. Clacton-on-Sea
dove house nursery nurseries and creches birmingham b27 6pl
8
Fraud - claim to be from VIRGIN. Spoke to Virgin as on my 7th call this morning. They confirmed it's fraud
ice cream - manufacturers cadwalader (ice cream) ltd - Criccieth
interior designers and furnishers mcc mosaics & design (London)
unkown , outside london didnt leave msg
fox and sons bournemouth real estate agencies
Told me in entered in a prize draw for cash
Calling to check on Domain setup progress and try to upsell some items.
Claims they are calling about a vehicle accident in the last few years, load of rubbish
dromore meats butchers dromore county down
Call centre
It is a genuine number AXA insurance but i missed the call - it was authorised by me as I had performed an online insurance quote with them the previous night.
dentists g r barker and partners oswestry
The administration of the website called.co.uk invites you to post comments about this phone number.
taxis and private hire a 1 rushmoor radio taxis aldershot hampshire
Motorcycles - general r p m motorcycles
livestock and others westall's burnley lancashire
roderick james architects llp totnes other business activities
juniper house interiors
The administration of the website called.co.uk invites you to post comments about this phone number.
Fraud
electronic vision international uk ltd leicester
Curtain and Blind Fittings The Carolina Blind Co Bishop's Stortford
bulb growers m g reid
jentone ltd london
222 ministries camberley surrey
Called to offer their property marketing services
john a eaton - newsagents - retail Huddersfield
lismore instruments ltd
fishing for recent car accidents
coins and medals douglas g barney colyton
Missed call
accessories and parts pit stop autospares bolton lancashire
Solihull
court residential ltd builders rugby cv23 8be
divers equipments dive initiative ltd