1162101833 (01162101833)
Who called me from phone number 1162101833 Leicester
Who called me from 1162101833
Phone number 1162101833 it's a landline number from Leicester. This phone number has been searched 1 times. The first search was on 2026-02-20 09:52:48 and the last on 2026-02-20 10:53:48. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1162101833 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+44116
Phone number 1162101833 - 0 opinions
Reviews for phone number 1162101833
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1162101833
QR Codes for number +44 1162101833




Phone number 1162101833 (+441162101833)
Country: United Kingdom
Country code: +44 (0044)
City: Leicester
Directional local: 116 (0116)
Code: 44116 (0044116)
This number was searched 1 times
First date of search: 2026-02-20 09:52:48
Date of last check of this number: 2026-02-20 10:53:48
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 381012611
A similar number: 116210127, 116210374, 116210302, 116210767, 111010183, 111010183, 118510183, 118910183(11 62 10 127,11 62 10 374,11 62 10 302,11 62 10 767,11 10 10 183,11 10 10 183,11 85 10 183,11 89 10 183)
Previous phone numbers: 1162101832 1162101831 1162101830 1162101829 1162101828 1162101827 1162101826 1162101825 1162101824 1162101823 1162101822 1162101821 1162101820 1162101819 1162101818 1162101817 1162101816 1162101815 1162101814 1162101813 1162101812 1162101811 1162101810 1162101809 1162101808 1162101807 1162101806 1162101805 1162101804 1162101803 1162101802 1162101801 1162101800 1162101799 1162101798 1162101797 1162101796 1162101795 1162101794 1162101793 1162101792 1162101791 1162101790 1162101789 1162101788 1162101787 1162101786 1162101785 1162101784 1162101783 1162101782 1162101781 1162101780 1162101779 1162101778 1162101777 1162101776 1162101775 1162101774 1162101773 1162101772 1162101771 1162101770 1162101769
Next phone numbers: 1162101834 1162101835 1162101836 1162101837 1162101838 1162101839 1162101840 1162101841 1162101842 1162101843 1162101844 1162101845 1162101846 1162101847 1162101848 1162101849 1162101850 1162101851 1162101852 1162101853 1162101854 1162101855 1162101856 1162101857 1162101858 1162101859 1162101860 1162101861 1162101861 1162101862 1162101863 1162101864 1162101865 1162101866 1162101867 1162101868 1162101869 1162101870 1162101871 1162101872 1162101873 1162101874 1162101875 1162101876 1162101877 1162101878 1162101879 1162101880 1162101881 1162101882 1162101883 1162101884 1162101885 1162101886 1162101887 1162101888 1162101889 1162101890 1162101891 1162101892 1162101893 1162101894 1162101895 1162101896 1162101897 1162101898 1162101899 1162101900 1162101902 1162101902 1162101903
(Previous phone numbers: 01162101832 01162101831 01162101830 01162101829 01162101828 01162101827 01162101826 01162101825 01162101824 01162101823 01162101822 01162101821 01162101820 01162101819 01162101818 01162101817 01162101816 01162101815 01162101814 01162101813 01162101812 01162101811 01162101810 01162101809 01162101808 01162101807 01162101806 01162101805 01162101804 01162101803 01162101802 01162101801 01162101800 01162101799 01162101798 01162101797 01162101796 01162101795 01162101794 01162101793 01162101792
Next phone numbers: 01162101834 01162101835 01162101836 01162101837 01162101838 01162101839 01162101840 01162101841 01162101842 01162101843 01162101844 01162101845 01162101846 01162101847 01162101848 01162101849 01162101850 01162101851 01162101852 01162101853 01162101854 01162101855 01162101856 01162101857 01162101858 01162101859 01162101860 01162101861 01162101861 01162101862 01162101863 01162101864 01162101865 01162101866 01162101867 01162101868 01162101869 01162101870 01162101871 01162101871 01162101872)
+44 01162101833 reviews
Add your opinion about +441162101833
UK 1162101833
whose phone number is this for free
Who called from number 1162101833
You can rate other simmilar phone numbers from Leicester, searched in our database
| 1162121242 | 1162187427 | 1162182899 |
| 1162534524 | 1162612204 | 1162129856 |
Random searched phone numbers
| 383 399 4450 | 367 490 870 | 286 464 2275 |
| 175 196 4094 | 334 033 9093 | 619 693 6084 |
Top rated phone numbers
1916740245 very polite and helpful never been happier with the savings this company LGH has made me highly recommend1340202106 I find these calls totally intrusive on my everyday life I want them to stop so please tell me what to do I am an old age pensioner and find these calls very harassing and str
1613394118 menswear savage ashton-under-lyne lancashire
2087493388 typesetters - print word setting group London
1217329961 Rang off when I answered
1622845443 It039s the energy helpline
2080891744 Information
7850434989 SCAM - states internet supplier has detected illegal activity and will disconnect in 24 hours unless speak to executive Automated
1226722262 textile floorcoverings f mount son contracts ltd barnsley
2084648222 paper and cardboard anthony dunne decorators bromley
1665710381 Guest Houses Harbour Guest House Morpeth Northumberland
1206385564 michael j page computers ltd colchester k business services
1924490052 adminquick ltd mirfield 7412
1792828958 Do not answer this number unless you like surveys I dont like surveys so will not answer
1324630660 Motorcycles - general r p m motorcycles
1383515010 pubs bars and inns jay tees
1772822440 general stores - retail a h motara preston lancashire
1732883079 w h simmonds and son ltd sevenoaks construction
1233625574 land surveyors ordnance survey ashford
1494463409 colorscan high wycombe g wholesale and retail
7713053057 calls and hangs up when answered
173552747 This call was an automated voice call and claimed to be Amazon and stated that there had been a larger than usual claim on my credit card Its obviously a scam and I have reported it to Amazon
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
2034574173 no comment just says good bye
2085974401 training and career matters ltd romford education
879796285 SPAM
2037792156 accident claim
7792678197 not wanted
1792582346 glaziers r p heaven - Swansea
8454290073 This is Holmes Financial Services based in Liverpool Scam message there is no free plan to clear your debts at a month Reported for misleading sales
Number popularity chart 1162101833
Your opinion about telephone number 1162101833 (116 210 1833)
Who called from 01162101833?: Who called now from Leicester ??? If you don't know who called you, you you shouldn't call back to this this phone number. Stay safe and Use our phone number feedback service. Check reviews and phone number ranking add your own review and instruct others if they should answer this incoming call. If you know which company or service called from this phone number, please inform others so that they can get information on our website. If you think this number might be dangerous please review the opinions of other internet users. If you can't call back this phone number is unknown to you. Try to check the opinions about this number first. Who can call. If you are not sure who is calling you from an unknown number First check this number and then you can either call back or wait as he call again. Whose phone number is this for free.
Possible number records of 01162101833 01162-101-833
+441162101833 |
00441162101833 |
1162 101 833 |
11 62 10 183 3 |
116 21 01 83 3 |
11-62-10-183 3 |
0044 1162-101-833 |
00 44 116 21 01 833 |
(+44)1162101833 |
11 62 10 183 3 |
(11) 6210 183 3 |
00 44 (11)6 21-01-83-3 |
+441162101833 In words... 116 210 1833
one one six two one zero one eight three |
eleven sixty two ten eighteen thirty three |
Possible number records of 1162101833
Last rated phone numbers
1908103106, 1997362534, 1135349294, 1243581118, 2080626791, 7359572537, 3316301485, 7700199390, 7418601778, 1614644147, 7755212697, 7970256975, 7561096311, 2036215808, 7359277300, 7359340657, 7359828840, 7942051543, 7368306262, 7359825615, 2922640201, 4917655756277, 212646663105, 2031371870, 7477172814, 2922711579, 7768210969, 1758265326, 7518173234, 19095701903, 1324232041, 7893, 1202933184, 2922641913, 7588685354, 35722032305, 1156610601, 1135127671, 3330459521, 330459561, 1135190879, 8445301538, 353877821258, 7801476318, 7445742398, 63366, 8000113312, 7473168971, 7763449748, 8659732684,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988494077
- Pageviews today : 664477
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
1162101833
+441162101833
National Hearing Helpline or National Hearing Centre - doesn't matter what name, the context is the same - pure telemarketing. They just try, same story : "Have you ever worked in a noisy environment...?" In fact insurance business, and in fact telemarketing, unsolicited call in my case. Probably can be helpful, but does someone have a possitive experience with them...?
Swindon
solicitors noel starke and co crawley
heritage corporate gifts buckingham
accountants d &co chakrabarti (London)
osteopaths fiveways osteopathic practice brighton
Salford
Scam call about domain names and services
places of worship victoria baptist church eastbourne
Silent call
solicitors e jensen east grinstead
swimming pools rutherglen swimming pool
demolition contractors kirkless hall demolition co wigan lancashire
Road Haulage E Harris Transport Rainham
mac phipps bristol south gloucestershire
business transfer agents harris & co. Manchester manchester
airnesco international ltd gillingham retail sale of electrical household appliances and
lurgi (uk) ltd woking
Prank caller.
fabaloy (southern) ltd access equipments haslemere gu27 1yl
Called me late evening. The lady mumbled her name and the company she was calling from, quoted my full name and an address I lives in two years ago. When I said I didn't live at this address she said 'oh, sorry' and hung up.
vanquis bank
Didn’t answer
delivery services quick bite warrington cheshire
Call threatening prison/for non payment of tax
This number comes from Cardiff, I don't answer unknown numbers and they left no message. Have missed calls from them on my mobile, was trying to dig some info on the internet before calling them back, but found nothing, no luck - probably just another insurance claims telemarketer... People pls did someone answer this number, who is it?
LYDNEY
driving schools carmyle driving centre ltd
Civil engineers g w j joinery contractor - Llangollen
This caller was extremely aggressive on the phone, I had trouble understanding him. He wanted to confirm the details of our address and told us we had been overpaying for our electricity. When I said we were not interested in switching provider, he promptly told me to F*** Off and P*** off!! Then hung up.
the anchor pubs, bars and inns woking gu23 6qw
sports clubs retford squash club ltd retford
beechwood veterinary group - animal welfare organisations Leeds
Fake HMRC call
lda living and learning cambridge g wholesale and retail
ambulance chaser
photography - general topham edenbridge
Saying you have been in a car accident
dove house nursery nurseries and creches birmingham b27 6pl
Pubs Bars and Inns Hare and Hounds Inn Hexham Northumberland
atomic design ltd altrincham
heating equipments b s s smethwick
nornova shetland manufacture of textiles
Nottingham
linthurst chartered tax advisers tax consultants bromsgrove b61 8da
m b label services ltd thetford d manufacturing
local authority schools woodlands special school plymouth
tom petchey blackwood gwent
salisbury leather merchants parker accessories ltd
The administration of the website called.co.uk invites you to post comments about this phone number.
chambers of commerce whitstable district chamber of commerce whitstable
My number is now being passed around call centres up and down country. Now keeping a log to start proceedings against them
hotels lloyds hotel llanidloes
Number not recognised when you dial back. Spam
strysin buckingham buckinghamshire
This company should be prosecuted for harassment.
Received a call this evening from 02032875165 - foreign accent, stating I had been selected by UK Government to receive a tax free grant of £8000. Apparently I was selected because I was a good bill payer and did not have a criminal record ! I was given a claim reference number and asked to call this number back within 25 minutes and speak to a manager who will release the money to me. I didn't bother calling back. What's the old phrase? If something's too good to be true it probably isn't !
the northern ireland community relations council information services belfast ulster
roy king jewels ltd london d manufacturing
marney's village inn pubs, bars and inns esher kt10 8jn
plumbing and heating t jolly (services) ltd. Preston lancashire
Eye Hospital. But fax machine when called them back.
fishing and angling weights baits and tackle southampton hampshire
To close the message down without having to resart your computer: Press CTRL-ALT-DEL, choose the Task Manager option and then select the programme you want to close down, i.e. Firefox, Chrome, Explorer etc.
Called from this number by someone who sounded very Indian claiming to be from "internet provider TalkTalk" (I m not with them). It turned out to be the www.teamviewer.com / www.support.me scam where they claim "something is wrong with your computer" (they never tell you what). They then ask if there are lights flashing on your router - they should, of course, but they pretend that indicates a fault. I led them quite a dance for an hour and a half before getting fed up with struggling to understand their
unknown number
clayton construction ltd weston super mare erection of roof covering and frames
aichess print kidderminster
The administration of the website called.co.uk invites you to post comments about this phone number.
Suspected scam call - Indian lady said she was from Telephone Marketing Services (Not TPS) saying she could put a stop to unwanted telemarketing calls. She also rang a couple of weeks ago and I said NOT to call me again and to remove my number from her list.
mcdougall surveyors isle of bute k business services
flowers and shrubs pinegrove interior landscapes
anfield transport road haulage craigavon county armagh
Inverness
stevesimmonsnet (procurement) camberley
take away gala delicatessen (London)
wooden poetry kitchen ware burgess hill rh15 0sr
Honda Milton Keynes Dealer
party plan agents harmony
stack and computer solutions ltd bootle k business services
Scam regarding a car crash that never happened, block.
Not telemarketing and nothing to fear from a Which? Trusted Trader
phoned me 7 times today !!!!!!!
advanced battery care ltd marlborough
convenience stores hugh clark
Keeps calling me, I say hello and I get no response, hardly seems like the type of thing an official number would do several days in a row
airline services reed operations liverpool merseyside
reading
caller hangs up when phone is answered
museums and galleries museum exhibitions ltd (London)
National Trust - re holiday cottages - genuine number
guttering services alpine gutters
key alliance co ltd reading other business activities not elsewhere classified
waddington & ledger ltd - printers Elland
VERY BAD ENGLISH OMG!
estate agents octavia estates (London)
control panels systems a campbell electrical services
gambling or something. blocked
health foods and products holland & barrett birkenhead merseyside
SOUTH SHIELDS