796856280 (0796856280)
Who called me from phone number 796856280
Who called me from 796856280
Phone number 796856280 it's a mobile number from the unknown network. This phone number has been searched 1 times. The first search was on 2026-02-20 09:52:09 and the last on 2026-02-20 10:53:09. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
796856280 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+44
Phone number 796856280 - 0 opinions
Reviews for phone number 796856280
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 796856280
QR Codes for number +44 796856280




Phone number 796856280 (+44796856280)
This number was searched 1 times
First date of search: 2026-02-20 09:52:09
Date of last check of this number: 2026-02-20 10:53:09
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 082658697
A similar number: 796856543, 796856329, 796856662, 796856271, 795756280, 795756280, 796056280, 791356280(79 68 56 543,79 68 56 329,79 68 56 662,79 68 56 271,79 57 56 280,79 57 56 280,79 60 56 280,79 13 56 280)
Previous phone numbers: 796856279 796856278 796856277 796856276 796856275 796856274 796856273 796856272 796856271 796856270 796856269 796856268 796856267 796856266 796856265 796856264 796856263 796856262 796856261 796856260 796856259 796856258 796856257 796856256 796856255 796856254 796856253 796856252 796856251 796856250 796856249 796856248 796856247 796856246 796856245 796856244 796856243 796856242 796856241 796856240 796856239 796856238 796856237 796856236 796856235 796856234 796856233 796856232 796856231 796856230 796856229 796856228 796856227 796856226 796856225 796856224 796856223 796856222 796856221 796856220 796856219 796856218 796856217 796856216
Next phone numbers: 796856281 796856282 796856283 796856284 796856285 796856286 796856287 796856288 796856289 796856290 796856291 796856292 796856293 796856294 796856295 796856296 796856297 796856298 796856299 796856300 796856301 796856302 796856303 796856304 796856305 796856306 796856307 796856308 796856308 796856309 796856310 796856311 796856312 796856313 796856314 796856315 796856316 796856317 796856318 796856319 796856320 796856321 796856322 796856323 796856324 796856325 796856326 796856327 796856328 796856329 796856330 796856331 796856332 796856333 796856334 796856335 796856336 796856337 796856338 796856339 796856340 796856341 796856342 796856343 796856344 796856345 796856346 796856347 796856349 796856349 796856350
(Previous phone numbers: 0796856279 0796856278 0796856277 0796856276 0796856275 0796856274 0796856273 0796856272 0796856271 0796856270 0796856269 0796856268 0796856267 0796856266 0796856265 0796856264 0796856263 0796856262 0796856261 0796856260 0796856259 0796856258 0796856257 0796856256 0796856255 0796856254 0796856253 0796856252 0796856251 0796856250 0796856249 0796856248 0796856247 0796856246 0796856245 0796856244 0796856243 0796856242 0796856241 0796856240 0796856239
Next phone numbers: 0796856281 0796856282 0796856283 0796856284 0796856285 0796856286 0796856287 0796856288 0796856289 0796856290 0796856291 0796856292 0796856293 0796856294 0796856295 0796856296 0796856297 0796856298 0796856299 0796856300 0796856301 0796856302 0796856303 0796856304 0796856305 0796856306 0796856307 0796856308 0796856308 0796856309 0796856310 0796856311 0796856312 0796856313 0796856314 0796856315 0796856316 0796856317 0796856318 0796856318 0796856319)
+44 0796856280 reviews
Add your opinion about +44796856280 (0796) 856-280
UK 796856280
306 area code
Who called from number 796856280 (079) 685-6280
You can rate other simmilar phone numbers searched in our database
| 796847005 | 796869872 | 796828983 |
| 796362676 | 796845707 | 796870730 |
Random searched phone numbers
| 497 422 383 | 836 157 2754 | 443 177 3533 |
| 646 876 769 | 499 194 1338 | 490 090 6310 |
Top rated phone numbers
1415703200 PPI COMPANY SACK THEM OFF1752660281 nhs clinics nuffield clinic plymouth
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
7534954942 Croydon
2077036431 dental technicians walworth dental laboratories London
1494891757 dahl and dahl great missenden recreational cultural and sporting activities
1202581645 hospital equipments grazedean ltd bournemouth dorset
1225705242 melksham indian the melksham tandoori
2476350575 amcast ltd nuneaton g wholesale and retail
9685849843 09685849843
2380284420 builders keith and paul searle lyndhurst hampshire
3003008033 The administration of the website calledcouk invites you to post comments about this phone number
2079789668 supermarkets brixton supermarket London
1217052566 peter n huntley dentists solihull b91 3ha
2084284318 burglar alarm systems specialised air conditioning services London
1743367225 photographers meridian photography shrewsbury
1925210011 delivery services quick bite warrington cheshire
1766512505 tom parry and co porthmadog k business services
1772204096 social services care and repair
1162624296 Leicester
1784258639 pallets crates and packaging imperial packing services London
2085216644 stamp dealers w d s thorn London
1274861865 Do not answer this call Rude personal attempting to collect personal data No service offered no reason for call given Unnerving
1754880371 wainfleet magdalen primary school skegness education
1159686326 boots contract manufacturing nottingham d manufacturing
1704536476 fashion shops jeanster southport merseyside
1638712720 thermoreg products ltd bury st edmunds
1217900568 Scam call about domain names and services
1656649639 joinery acacia joinery ltd - Bridgend
1132645422 beechwood veterinary group - animal welfare organisations Leeds
Number popularity chart 796856280
Your opinion about telephone number 796856280 (796 856 280)
Who called from 0796856280?: Stay safe through our website with opinions about mobile and landline numbers. Check and add your own opinions about the unknown number you are currently browsing Share with others your experience who called from this phone number. This is very necessary for other users who will check this phone number in the future. Maybe you will someday check this phone number again so our site will serve as a storage space or a base for your opinions and opinions of other users in one place. If you don't know who called you from this unknown phone number, first check this number in our number database. It may be a positive number, but it may turn out that this number is a negative number that causes fees or that Phishing personal data. 306 area code. Perhaps this is the number of an advertising agency or marketing company that wants to offer you unwanted services. Maybe this is a call center that I am trying to reach you in connection with a case in an office or bank or other company. Invite others to use this site to add feedback about unknown phone numbers.
Possible number records of 0796856280 0796-856-280
+44796856280 |
0044796856280 |
796 856 280 |
79 68 56 280 |
796 85 62 80 |
79-68-56-280 |
0044 796-856-280 |
00 44 796 85 62 80 |
(+44)796856280 |
79 68 56 280 |
(79) 6856 280 |
00 44 (79)6 85-62-80- |
+44796856280 In words... 796 856 280
seven hundred ninety six eight hundred fifty six two hundred eighty |
seven nine six eight five six two eight zero |
Possible number records of 796856280
Last rated phone numbers
2031487678, 8442843421, 7591335998, 1285332633, 2037810895, 1422774506, 1618189743, 7548881046, 1329558540, 1902937418, 1235627887, 7458030387, 7984162540, 2080495903, 1515257555, 7399183893, 1135349146, 7404665257, 7702519784, 1442255422, 1822874751, 7477458572, 2921280155, 7553324573, 1214681657, 1324232034, 1827216401, 7482766278, 7932213339, 1223217746, 7765746464, 7719108109, 7719108109, 7719108109, 2080793071, 7883305092, 7893056461, 1623829653, 1162764164, 7477451471, 7455397029, 1162547383, 2045716901, 2476396145, 7359838881, 7359838881, 3300430239, 7838562185, 3456723723, 918013550295,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988493385
- Pageviews today : 663785
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
796856280
+44796856280
swiftprint huddersfield d manufacturing
not wanted
framing services craft world unique frames sheffield
bradfordautosignproducts bradford west yorkshire
Flooring Services Anchor Installations Ltd Leigh On Sea
saltours international ltd london 6330004 hotel booking agencies
SCAM
doctors general practitioners the cowes health centre cowes isle of wight
tom parry and co porthmadog k business services
phil bennellick plymouth devon
local authority schools holy cross & saint mary's j m I school liverpool merseyside
reed computing personnel bristol
SNODLAND
calls and hangs up when answered
menswear hugo boss
Museums and Galleries Essex Secret Bunker Manningtree
ergonomics symbiotics ltd horsham
hodges ceilings ltd uckfield construction
beauty saloons the house of beauty barnsley
dennis a lakin painter and decorators oldbury b68 8ep
n j m (guildford) ltd. Stationery guildford gu4 7wa
People did someone answer this number? I had few missed calls from this one, probably some call centre robocaller testing my number? I don't answer unknown numbers and they left no message. I was trying to dig some info on the internet, don't want to call them back until I know who might be calling but no luck. Some idea who is it?
galloway antiques fairs harrogate other business activities
Painter and Decorators Malfield Decor Romford
Builders Ryan Group Clacton-on-Sea
florists - retail c suett & son (London)
Same 'you have won £650k' scam.
Engineers Warrensville File and Knife Uk St Helens Merseyside
Thornton Heath
electrical goods scc electrical wholesalers sheffield
capita hartshead sheffield j financial intermediation
southwater construction ltd builders thornton heath cr7 8lz
It is a number for Waste Managed Ltd. They used to be Cheaperwaste Ltd. Terrible waste brokers in Newcastle. One to avoid so don't let them have your bank account number, or let them start a contract for you. There is a Facebook group, Cheaperwaste Waste Managed Unhappy Customers which reports terrible things.
charities and voluntary organisations social services department lytham st annes lancashire
Aromatherapy h doyle
auto body repairs j c autos todmorden lancashire
social media consultants limited rickmansworth hertfordshire
Ppi nuisances
Advertised as a Toll free number charged over 21 euros for a 16 minute call.
waddington & ledger ltd - printers Elland
Blocked this number to many calls, so annoying.
party plan agents harmony
stationery the boss ltd tamworth
spam caller
exco consulting
called my mobile 6pm 9th june. there was no voice when I answered per another website, they are Cloud Contact Centre and Inside Sales Platform
LYDNEY
8
chauffeur driven cars brooklands chauffeur services southampton hampshire
local government aberdeen city council
Called today around 11am never answered the phone would like to know who calling please, so fed up with unwanted phone calls that you don't answer your phone ,when it could...
car valet complete car clean
laney electronics ltd electronic engineers cradley heath b64 6be
They introduced themselves as Red Hot legal - sounded like some sort of call centre. Not a personal number anyway
Was a local number to me so answered whilst abroad and it was someone saying I had been involved in an accident
finham library libraries - book coventry cv3 6ep
alexander hoskins crawley k business services
tru tools tool design and makers redditch b98 0ea
We've been informed you've been in a car accident that wasn't your fault.... ****
maintenance and repairs paul denton portsmouth hampshire
Electrical Engineers and Contractors P & R Coleman Ltd. Clacton-on-Sea
Electrical Engineers and Contractors Engineering Projects Development Ltd St Helens Merseyside
clothing and fabrics pearl irber ltdtd (London)
...aggressive and constant caller
freeman & pardoe ltd engineering services alcester b49 6es
A complete scam as my AV is up to date. Just close the browser and get on with your life
bull & son stationery surbiton kt6 4jz
timber merchants, importers and agents bristow and short ltd telford
wines spirits and beer - retail unwins wine merchants (London)
Received a call this evening from 02032875165 - foreign accent, stating I had been selected by UK Government to receive a tax free grant of £8000. Apparently I was selected because I was a good bill payer and did not have a criminal record ! I was given a claim reference number and asked to call this number back within 25 minutes and speak to a manager who will release the money to me. I didn't bother calling back. What's the old phrase? If something's too good to be true it probably isn't !
carton services ltd - print finishers Leeds
chiropodists - podiatrists a whiteing chesterfield
computer systems and software highlanders solutions ltd (London)
hotels lloyds hotel llanidloes
Rang off when I answered
barratt sales and marketing hitchin manufacture of food products and beverages
Tried to call me glad I didn t answer after reading this! They get your number if a payment on an agreement defaults (for what ever reason!)
SCAM Recorded message about renewing my Amazon subscription for £39.99 (?). Press 1 to cancel. I hung up before being charged or otherwise fleeced by this scammer.
Rings several times a day. I'm sick of it so blocked it ...
Missed call
security services monarch security systems southampton hampshire
glass merchants t a anders & co. Ltd. Salford lancashire
This company should be prosecuted for harassment.
florists - retail rosies florist (London)
hamilton fuels fuel dealers armagh county armagh
greengrocers stokes plc dawlish
air condition and refrigeration unit air conditioning systems ltd orpington
SCAM / SPAM
The administration of the website called.co.uk invites you to post comments about this phone number.
Keighley
Frimley
public relations flagship marketing ltd (London)
BT about open reach phone line checking who your provider is and that you are happy with the way your service runs through the line
I used this company and the did successfully claim ?2000 from a company I didn t know I had ppi with. That s the good news. The bad news was the flood of harassment calls and letters demanding their payment before I even had chance to bank the cheque. I got two invoices within 2 days. I ended up opening both together. Then about 4 phone calls. Despite the fact that I gave them a date I would send a cheque in, estimating the date my cheque would clear. They tried to persuade me to pay by credit card over the
sick of them always calling
s i s jensen uxbridge manufacture of furniture manufacturing nec
peter coles builders warwick cv35 8ew
I get calls Atleast once a week from this number
steel stockholders mealham metal products ashford
The overall rating for phone number 01453769358 is Harassing