1925119293 (01925119293)
Who called me from phone number 1925119293 Warrington
Who called me from 1925119293
Phone number 1925119293 it's a landline number from Warrington. This phone number has been searched 1 times. The first search was on 2026-02-20 09:58:50 and the last on 2026-02-20 10:59:50. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1925119293 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-20
Directional:
+441925
Phone number 1925119293 - 0 opinions
Reviews for phone number 1925119293
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1925119293
QR Codes for number +44 1925119293




Phone number 1925119293 (+441925119293)
Country: United Kingdom
Country code: +44 (0044)
City: Warrington
Directional local: 1925 (01925)
Code: 441925 (00441925)
This number was searched 1 times
First date of search: 2026-02-20 09:58:50
Date of last check of this number: 2026-02-20 10:59:50
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 929115291
A similar number: 192511811, 192511673, 192511201, 19251186, 196111929, 196111929, 196211929, 199911929(19 25 11 811,19 25 11 673,19 25 11 201,19 25 11 86,19 61 11 929,19 61 11 929,19 62 11 929,19 99 11 929)
Previous phone numbers: 1925119292 1925119291 1925119290 1925119289 1925119288 1925119287 1925119286 1925119285 1925119284 1925119283 1925119282 1925119281 1925119280 1925119279 1925119278 1925119277 1925119276 1925119275 1925119274 1925119273 1925119272 1925119271 1925119270 1925119269 1925119268 1925119267 1925119266 1925119265 1925119264 1925119263 1925119262 1925119261 1925119260 1925119259 1925119258 1925119257 1925119256 1925119255 1925119254 1925119253 1925119252 1925119251 1925119250 1925119249 1925119248 1925119247 1925119246 1925119245 1925119244 1925119243 1925119242 1925119241 1925119240 1925119239 1925119238 1925119237 1925119236 1925119235 1925119234 1925119233 1925119232 1925119231 1925119230 1925119229
Next phone numbers: 1925119294 1925119295 1925119296 1925119297 1925119298 1925119299 1925119300 1925119301 1925119302 1925119303 1925119304 1925119305 1925119306 1925119307 1925119308 1925119309 1925119310 1925119311 1925119312 1925119313 1925119314 1925119315 1925119316 1925119317 1925119318 1925119319 1925119320 1925119321 1925119321 1925119322 1925119323 1925119324 1925119325 1925119326 1925119327 1925119328 1925119329 1925119330 1925119331 1925119332 1925119333 1925119334 1925119335 1925119336 1925119337 1925119338 1925119339 1925119340 1925119341 1925119342 1925119343 1925119344 1925119345 1925119346 1925119347 1925119348 1925119349 1925119350 1925119351 1925119352 1925119353 1925119354 1925119355 1925119356 1925119357 1925119358 1925119359 1925119360 1925119362 1925119362 1925119363
(Previous phone numbers: 01925119292 01925119291 01925119290 01925119289 01925119288 01925119287 01925119286 01925119285 01925119284 01925119283 01925119282 01925119281 01925119280 01925119279 01925119278 01925119277 01925119276 01925119275 01925119274 01925119273 01925119272 01925119271 01925119270 01925119269 01925119268 01925119267 01925119266 01925119265 01925119264 01925119263 01925119262 01925119261 01925119260 01925119259 01925119258 01925119257 01925119256 01925119255 01925119254 01925119253 01925119252
Next phone numbers: 01925119294 01925119295 01925119296 01925119297 01925119298 01925119299 01925119300 01925119301 01925119302 01925119303 01925119304 01925119305 01925119306 01925119307 01925119308 01925119309 01925119310 01925119311 01925119312 01925119313 01925119314 01925119315 01925119316 01925119317 01925119318 01925119319 01925119320 01925119321 01925119321 01925119322 01925119323 01925119324 01925119325 01925119326 01925119327 01925119328 01925119329 01925119330 01925119331 01925119331 01925119332)
+44 01925119293 reviews
Add your opinion about +441925119293
UK 1925119293
pictures of iphone 5
Who called from number 1925119293
You can rate other simmilar phone numbers from Warrington, searched in our database
| 1925123124 | 1925196496 | 1925135681 |
| 1925239725 | 1925792553 | 1925207244 |
Random searched phone numbers
| 334 389 0380 | 444 586 3682 | 617 995 3700 |
| 837 640 0184 | 323 520 693 | 812 394 7250 |
Top rated phone numbers
2088853547 jentone ltd london2086902242 letting agents burnet ware graves London
1214960754 apparently scammers never answered
1708242184 Safe number
1253290092 cobains blackpool other business activities
7878970069 esler stirling
1923650200 lenta business space ltd watford k business services
1543571299 caterers carousel catering cannock ltd cannock
1179428491 venue magazine ltd bristol publishing and media
1217452772 park human resources ltd advertising agencies solihull b90 4qt
1619898679 SCAM
7779323564 amanda marriott redditch worcestershire
1675242135 01675242135 is a SCAM supposedly from sky about internet connection fault Asian sounding voice call traced to COLESHILL NOT TRUESCAMMER
1157690105 pensions caller
7427419832 Tax fraud scam
7537177342 SCAM SPAM tried to collect bank details infos
1144409993 Start calling me a rude name and lots of foreign people laughing and speaking in background The guy on the phone was abusive and extremely sarcastic to me
1706646226 travel agents lunn poly ltd Rochdale lancashire
1213847817 dolphin foods supermarkets birmingham b24 8eh
730818793 SCAM SPAMpretends to be nationwide and texts you due to a fake security threat do not click the link
1554758338 llanelli waste service centre llanelli collection and treatment of other waste
1425482824 car upholsterers retail posh wash professional car valeting ringwood hampshire
1843226798 MARGATE
1246412163 plumbing and heating steven g lee dronfield
1924481081 the white gate - pubs bars and inns Mirfield
7703218192 07703218192
1702523126 Places of Worship St David C Of E Church Leigh On Sea
7884076872 SCAM warning - DO NOT click the link07884 076872 texted me on 10th March at 1532HSBC ALERT Transfer attempt on hold to a NEW PAYEE If this was not you STOP this athttpshelp-reviewmytransferslivehsbc
1914139770 communication management services ryton post and telecommunications
2089070088 financial consultants claywood financial services ltd London
Number popularity chart 1925119293
Your opinion about telephone number 1925119293 (192 511 9293)
Tags for whocalledmeuk.co.uk: Pictures of iphone 5 1 9 2 5 1 1 9 2 9 3, 01925119293, check mobile number,who called me,whose number is this,check phone number,check phone number owner,check telephone number,company phone number lookup, free reverse call lookup cell phones, free reverse phone number information, iphone sleeve, prepaid, trace mobile number, whos numbers this, what is cell phone, , find address from phone number,find mobile number,find phone number by name,find phone number owner,find telephone number,how to track a phone number,mobile number tracker,mobile phone checker,mobile phone number,mobile phone number tracker,number finder,number search,online phone number,phone book,phone directory,phone line checker,phone number address,phone number checker free, phone number identifier,phone number lookup,phone number search,phone number search by address,who called me uk,phone number tracker,residential phone numbers,reverse lookup,reverse phone lookup,telephone directory,telephone number,telephone number trace,who number is this,who's telephone number is this?
Possible number records of 01925119293 01925-119-293
+441925119293 |
00441925119293 |
1925 119 293 |
19 25 11 929 3 |
192 51 19 29 3 |
19-25-11-929 3 |
0044 1925-119-293 |
00 44 192 51 19 293 |
(+44)1925119293 |
19 25 11 929 3 |
(19) 2511 929 3 |
00 44 (19)2 51-19-29-3 |
+441925119293 In words... 192 511 9293
one thousand nine hundred twenty five one hundred nineteen two hundred ninety three |
one nine two five one one nine two nine |
Possible number records of 1925119293
Last rated phone numbers
7731580046, 2045206079, 7375990206, 1604821234, 7471433059, 7471433059, 1217842830, 2076246906, 1604779440, 7519739849, 7790994982, 12037986146, 3301748895, 7443751910, 7944885123, 1224713641, 7950911863, 1225535056, 7956448442, 7359476687, 1803549245, 7396806106, 790786385673, 7368306262, 7594235722, 1792734427, 2036080597, 3301748875, 3303413424, 2083008111, 1692535495, 2030932842, 7530804286, 1313818532, 1223790441, 7570321729, 7498124837, 2921684152, 1415875108, 1642680768, 1902937417, 7459187265, 7983448588, 2077769568, 7983448588, 2085753599, 2085753599, 1858880646, 1772524147, 1223790377,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 16560
- Users online : 1382
- Bots online : 15178
- Google Bots : 1
- Unique users : 1360
- Unique bots : 1412
Who called me
Welcome to Who Called Me UK website (whocalledmeuk.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 988502037
- Pageviews today : 672437
- Number of comments : 2861811
- Positive ratings : 1267982
- Neutral evaluations : 899658
- Annoying ratings : 150902
- Dangerous assessments : 543269
1925119293
+441925119293
03453405696. Called. I answered itand there was nobody there. Just silence. Then they hung up.
dentists elfyn samuel - Llanelli
cobains blackpool other business activities
missed call from this number, who is it?
Blocked by blocker called twice today. Checked number out seems some scam about winning a holiday & them wanting details. Some have said not to call them back. Not that I would.
blairchem ltd aberdeen
robins newsagents retail wallington sm6 9bn
b l d international fashion agency ltd london 5142007 clothing
newsagents - retail stamp & child dover
Scottish power unsolicited call
telemarketing.........
moor allerton hall primary school - local authority schools Leeds
overseas property agents crete property consultants (London)
company called Professional Reclaim Services
Unisex Hairdressers Hair Inspirations Chelmsford
camack ltd york wholesale trade and commission trade
menswear visual impact newport isle of wight
eyon components metal workers birmingham b6 4tn
london city roast belvedere london
SCAM
Safe number
frontline travel london activities of travel agencies and tour operators
We have been trying to contact you re your PPI Claim. We now have details of how much you are due. Reply POST for your pack or END to OptOut That's what it said
blacksmiths and forgemasters j malcolm & son
caller hangs up when phone is answered
Nottingham
philip lynn belfast k business services
Didn’t answer, called me times today
Halkirk
telecommunication services hutchison telecom (London)
pension ppi
financial consultants mountain financial services ltd lymington hampshire
adrian allen merton abbey london
Fejvadász, ha munkát keresel, vedd fel.
photographers meridian photography shrewsbury
deadeyedllama exeter devon
SCAM This is yet another number used in the “extremely time sensitive” fake HMRC scam. Hysterical, really. This is my 4th received call, picked up by ansaphone. Same female voice, but this time stating the caller’s identity as “Dennis Grey”. They’ve used different numbers to call from before, this is the first time they’ve used this number. HMRC SCAM, DO NOT RESPOND.
builders merchants thomas ainsworth builders merchants burnley lancashire
peter n huntley dentists solihull b91 3ha
bearings b s l ltd - Wrexham
peter coles builders warwick cv35 8ew
This is the second time I have been called from a Birmingham number. I had already blocked the number last time. It's the same company but I can't make the name out. I...
nursing homes eastyne home for the elderly worthing
apache components stevenage
Missed call
lv ward ltd 19 20 allen london g wholesale and retail
ashraf azhariqbal accountants birmingham b5 6bj
Automated call : assume automated call as no voice when I answered seem to be getting lots of these again ????
carpenters and joiners brighton interiors ltd worthing
calverley carpets
who is this who calls???
23 Nov 2021 - Just had a call from this number, but didn't answer as I was on another call. Good to know it was probably a suspicious call.Reply
Croydon
prizes claims ect
matrix grinding technologies birmingham
the dartington food co ltd ivybridge 1589
SCAM Pretending to be the HMRC
rest and retirement homes st brelades retirement homes ltd herne bay
plumbing and heating james a girgan
It's the energy helpline
charities and voluntary organisations social services department lytham st annes lancashire
Inverness
flightline support ltd witney supporting and auxilliary transport activities
sean mullan & son ltd builders limavady county londonderry
david ian gillies - accountants Wakefield
Typical Amazon Prime scam . recording of female voice.
brentwood centre
doctors general practitioners pinfold dental clinic walsall
printers express print ltd (London)
As soon as I pick up the phone they cut me off. They have been doing this for weeks. I now have caller display so let the ans phone take the call this way it still costs them for the call...:-)
cv check ltd paignton
Charity shops imperial cancer research fund
About an accident that I had that wasn t my fault
Caller claims to have money from a PPI on your credit card
computer systems and software acucorp u k ltd (London)
drs lord lord findlay smith & sawczyn - nhs clinics Halifax
waltham plumbing supplies ltd grimsby g wholesale and retail
1234567891
p s s europe ltd
Rang off when I answered
Recorded message saying that call was from HMRC doing an investigation, please contact- unlikely so assume it is a SCAM
Just put the phone down on me. No doubt seeing if Humber was active
doors and shutters, supp the door store telford
great taxi service. friendly helpful drivers
fds international ltd london marketing industry
barkers skoda - commercial vehicle dealers Leeds
Coventry
annoying call
dsv tuition services limited abingdon oxfordshire
Dials at antisocial times so you will call them back on their premium rate number
Scam call about domain names and services
Belfast
olympus welding and industrial supplies grimsby d manufacturing
I grobler dentists farnham gu9 7lp
the usual * uv had a car accident* crap
One of the sheff hallam uni contact numbers
hanson (machinery) transport - road haulage Bradford
non rispondo più a nessun call center
aceblade ltd - stone merchants Brighouse
dentists t zaki (London)